Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Dec 2011.
Explore 3QQ4 in 3D Show helices and sheets RCSB PDB PDBe
3QQ4 contains 14 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-14 | 11 | 1 |
| β-strand | 19-28 | 10 | 1 |
| β-strand | 31-37 | 7 | 1 |
| β-strand | 46-47 | 2 | 1 |
| α-helix | 50-52 | 3 | |
| α-helix | 57-84 | 28 | |
| β-strand | 94-103 | 10 | 1 |
| β-strand | 109-118 | 10 | 1 |
| β-strand | 121-126 | 6 | 1 |
| β-strand | 133-135 | 3 | 1 |
| α-helix | 138-149 | 12 | |
| α-helix | 152-159 | 8 | |
| α-helix | 160-164 | 5 | |
| α-helix | 165-174 | 10 | |
| α-helix | 176-179 | 4 | |
| β-strand | 183 | 1 | 2 |
| α-helix | 184-185 | 2 | |
| β-strand | 186-193 | 8 | 3 |
| β-strand | 199-208 | 10 | 3 |
| β-strand | 209 | 1 | 2 |
| β-strand | 214-219 | 6 | 4 |
| β-strand | 223 | 1 | 4 |
| β-strand | 229-230 | 2 | 3 |
| α-helix | 231-233 | 3 | |
| β-strand | 234-235 | 2 | 3 |
| β-strand | 241-249 | 9 | 3 |
| α-helix | 253-256 | 4 | |
| β-strand | 257-262 | 6 | 4 |
| β-strand | 270-272 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 5 |
| α-helix | 6-7 | 2 | |
| β-strand | 8-13 | 6 | 6 |
| β-strand | 23-32 | 10 | 6 |
| β-strand | 33 | 1 | 5 |
| β-strand | 38-43 | 6 | 7 |
| β-strand | 46-47 | 2 | 7 |
| α-helix | 48-49 | 2 | |
| β-strand | 51-52 | 2 | 6 |
| α-helix | 53-55 | 3 | |
| β-strand | 56-57 | 2 | 6 |
| β-strand | 63-71 | 9 | 6 |
| β-strand | 79-84 | 6 | 7 |
| β-strand | 92-95 | 4 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-8 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MHC class I antigen | A | protein | 275 | Sus scrofa | O19244 (AlphaFold model) |
| Beta-2-microglobulin | B | protein | 100 | Sus scrofa | Q07717 (AlphaFold model) |
| VP35 | C | protein | 9 | Sudan ebolavirus | C4PK56 |
>3QQ4_1 MHC class I antigen (chains A) GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVPWIQQEGQEYW DRETRNVKETAQTYGVGLNTLRGYYNQSEAGSHTLQSMYGCYLGPDGLLLHGYRQDAYDG ADYIALNEDLRSWTAADMAAQITKRKWEAADEAERRRSYLQGLCVESLRRYLEMGKDTLQ RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGT FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD
>3QQ4_2 Beta-2-microglobulin (chains B) EFVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKD WSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
>3QQ4_3 VP35 (chains C) ATAAATEAY
Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides. Zhang, N., Qi, J., Feng, S. et al. J Virol (2011) 85:11709-11724. DOI 10.1128/JVI.05040-11 · PubMed
Other PDB entries of the same protein (UniProt O19244 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3QQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.