6LF8: MHC class I antigen

Crystal structure of pSLA-1*0401 complex with dodecapeptide RVEDVTNTAEYW. Determined by X-ray diffraction at 2.5 Å resolution. Released 3 Mar 2021.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Sus scrofa, unidentified influenza virus
Chains: 3
Atoms: 3,320
Mol. weight: 44.5 kDa
Released: 3 Mar 2021

Explore 6LF8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LF8 contains 12 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4-13	10	1
β-strand	20-28	9	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	51-54	4
α-helix	57-84	28
β-strand	94-103	10	1
α-helix	104	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-150	13
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-174	10
α-helix	176-179	4
α-helix	181-185	5
β-strand	186-193	8	2
β-strand	199-208	10	2
β-strand	214-218	5	3
β-strand	224	1	3
β-strand	229-230	2	2
α-helix	231-233	3
β-strand	234-235	2	2
β-strand	241-249	9	2
α-helix	254-256	3
β-strand	258-262	5	3
β-strand	270-272	3	3

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	4
β-strand	8-13	6	5
β-strand	23-32	10	5
β-strand	33	1	4
β-strand	37-43	7	6
β-strand	46-47	2	6
β-strand	51-52	2	5
α-helix	53-55	3
β-strand	56-57	2	5
β-strand	63-71	9	5
β-strand	79-85	7	6
β-strand	92-95	4	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A	protein	275	Sus scrofa	O19244 (AlphaFold model)
Beta-2-microglobulin	B	protein	97	Sus scrofa	Q07717 (AlphaFold model)
Arg-val-glu-asp-val-thr-asn-thr-ala-glu-tyr-trp	C	protein	12	unidentified influenza virus	P16082

Sequence of entity 1 (A), FASTA

>6LF8_1 MHC class I antigen (chains A)
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVPWIQQEGQEYW
DRETRNVKETAQTYGVGLNTLRGYYNQSEAGSHTLQSMYGCYLGPDGLLLHGYRQDAYDG
ADYIALNEDLRSWTAADMAAQITKRKWEAADEAERRRSYLQGLCVESLRRYLEMGKDTLQ
RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGT
FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B), FASTA

>6LF8_2 Beta-2-microglobulin (chains B)
ARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSF
YLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C), FASTA

>6LF8_3 ARG-VAL-GLU-ASP-VAL-THR-ASN-THR-ALA-GLU-TYR-TRP (chains C)
RVEDVTNTAEYW

Primary citation

Structure and Peptidomes of Swine MHC Class I with Long Peptides Reveal the Cross-Species Characteristics of the Novel N-Terminal Extension Presentation Mode. Wei, X., Wang, S., Wang, S. et al. J Immunol (2022) 208:480-491. DOI 10.4049/jimmunol.2001207 · PubMed

Other PDB entries of the same protein (UniProt O19244 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QQ4 2.1 Å, Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and…
3QQ3 2.59 Å, Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and…

Browse structure collections

About this viewer

MolViewer shows 6LF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.