3R45: CENP-A-Histone H4 Heterodimer

Structure of a CENP-A-Histone H4 Heterodimer in complex with chaperone HJURP. Determined by X-ray diffraction at 2.6 Å resolution. Released 6 Apr 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,899
Mol. weight: 40.4 kDa
Released: 6 Apr 2011

Explore 3R45 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R45 contains 9 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	64-76	13
β-strand	85-87	3	1
α-helix	88-116	29
β-strand	120-121	2	2
α-helix	123-139	17

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
α-helix	31-40	10
β-strand	45-46	2	2
α-helix	50-75	26
β-strand	80-81	2	1
α-helix	83-95	13

Chain C: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	16-40	25
α-helix	48	1
β-strand	49-50	2	1
β-strand	51	1	3
β-strand	56-59	4	3
β-strand	62-65	4	3
β-strand	70-73	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3-like centromeric protein A	A	protein	156	Homo sapiens	P49450 (AlphaFold model)
Histone H4	B	protein	103	Homo sapiens	P62805 (AlphaFold model)
Holliday junction recognition protein	C	protein	81	Homo sapiens	Q8NCD3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3R45_1 Histone H3-like centromeric protein A (chains A)
MGSSHHHHHHSQDPNSMGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRR
QGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVH
LFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Sequence of entity 2 (B), FASTA

>3R45_2 Histone H4 (chains B)
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Sequence of entity 3 (C), FASTA

>3R45_3 Holliday junction recognition protein (chains C)
SMLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYET
PQGLRIWGGRLIKERNEGEIQ

Primary citation

Structure of a CENP-A-histone H4 heterodimer in complex with chaperone HJURP. Hu, H., Liu, Y., Wang, M. et al. Genes Dev (2011) 25:901-906. DOI 10.1101/gad.2045111 · PubMed

Other PDB entries of the same protein (UniProt P49450 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CVD 1.3 Å, Crystal structure of human NRMT1 in complex with alpha-N-dimethylated human CENP-A peptide
6KDQ 1.5 Å, Crystal structure of human NRMT1 in complex with alpha-N-monomethylated human CENP-A…
6KDS 1.84 Å, Crystal structure of human NRMT2 in complex with alpha-N-monomethylated human CENP-A…
3NQJ 2.1 Å, Crystal structure of (CENP-A/H4)2 heterotetramer
7R5R 2.44 Å, Structure of the human CCAN CENP-A alpha-satellite complex
3NQU 2.5 Å, Crystal structure of partially trypsinized (CENP-A/H4)2 heterotetramer
5ZBX 2.58 Å, The crystal structure of the nucleosome containing histone H3.1 CATD(V76Q, K77D)
6E0P 2.6 Å, Cryo-EM structure of the centromeric nucleosome (Native alpha satellite DNA) in complex…
6E0C 2.63 Å, Cryo-EM structure of the CENP-A nucleosome (W601) in complex with a single chain…
3WTP 2.67 Å, Crystal Structure of the heterotypic nucleosome containing human CENP-A and H3.3
7PII 2.68 Å, Structure of the human CCAN CENP-A alpha-satellite complex
7U46 2.68 Å, Cryo-EM structure of CENP-A nucleosome (palindromic alpha satellite DNA) in complex with…

Browse structure collections

About this viewer

MolViewer shows 3R45 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.