3R65: MthK channel pore E92Q mutant

MthK channel pore E92Q mutant. Determined by X-ray diffraction at 1.8 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Methanothermobacter thermautotrophicus str. Delta H
Chains: 1
Atoms: 693
Mol. weight: 9.19 kDa
Released: 1 Feb 2012

Explore 3R65 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R65 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	20-42	23
α-helix	46-57	12
α-helix	70-98	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-gated potassium channel mthK	A	protein	82	Methanothermobacter thermautotrophicus str. Delta H	O27564 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3R65_1 Calcium-gated potassium channel mthK (chains A)
VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPHTPLGMYFTC
TLIVLGIGTFAVAVQRLLEFLI

Primary citation

Crucial points within the pore as determinants of K+ channel conductance and gating. Shi, N., Zeng, W., Ye, S. et al. J Mol Biol (2011) 411:27-35. DOI 10.1016/j.jmb.2011.04.058 · PubMed

Other PDB entries of the same protein (UniProt O27564 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LDC 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+
3LDD 1.45 Å, High resolution open MthK pore structure crystallized in 100 mM K+ and further soaked in…
6U9T 1.55 Å, Wild-type MthK pore in 50 mM K+
4HYO 1.65 Å, Crystal Structure of MthK Pore
6U9P 1.65 Å, Wild-type MthK pore in ~150 mM K+
2AEF 1.7 Å, Crystal Structures of the MthK RCK Domain in Ca2+ bound form
4HZ3 1.7 Å, MthK pore crystallized in presence of TBSb
3OUS 1.75 Å, MthK channel pore T59A mutant
6U9Y 1.8 Å, Wild-type MthK pore in 11 mM K+
4L74 1.84 Å, Ca2+-bound MthK RCK domain at 1.9 Angstrom with single ligand
6U9Z 1.95 Å, Wild-type MthK pore in 6 mM K+
2AEJ 2.1 Å, Crystal Structures of the MthK RCK Domain in no Ca2+ bound form

Browse structure collections

About this viewer

MolViewer shows 3R65 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.