3R66: Human ISG15

Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza virus B, Northeast Structural Genomics Consortium Target IDs HX6481, HR2873, and OR2. Determined by X-ray diffraction at 2.3 Å resolution. Released 8 Jun 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Influenza B virus, Homo sapiens
Chains: 4
Atoms: 4,009
Mol. weight: 62.47 kDa
Released: 8 Jun 2011

Explore 3R66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R66 contains 28 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	16-35	20
α-helix	42-65	24
α-helix	68-70	3
α-helix	74-90	17
α-helix	93-95	3
α-helix	97-100	4

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	16-35	20
α-helix	42-65	24
α-helix	68-70	3
α-helix	74-90	17

Chain C: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	14-17	4	1
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	1
α-helix	52	1
β-strand	53	1	1
α-helix	54	1
α-helix	60-62	3
β-strand	70-75	6	1
β-strand	82-87	6	2
β-strand	93-98	6	2
β-strand	103	1	3
α-helix	104-115	12
α-helix	119-121	3
β-strand	122-126	5	2
β-strand	129-130	2	2
α-helix	131	1
β-strand	136	1	3
α-helix	137-140	4
β-strand	147-152	6	2

Chain D: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	4
β-strand	14-17	4	4
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	4
α-helix	52	1
β-strand	53	1	4
α-helix	54	1
α-helix	60-63	4
β-strand	70-75	6	4
β-strand	82-87	6	5
β-strand	93-98	6	5
β-strand	103	1	6
α-helix	104-115	12
α-helix	119-121	3
β-strand	122-126	5	5
β-strand	129-130	2	5
α-helix	131	1
β-strand	136	1	6
α-helix	137-140	4
β-strand	147-152	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	113	Influenza B virus	P03502 (AlphaFold model)
Ubiquitin-like protein ISG15	C, D	protein	164	Homo sapiens	P05161 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3R66_1 Non-structural protein 1 (chains A, B)
MGHHHHHHSHMADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHR
LKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPY

Sequence of entity 2 (C, D), FASTA

>3R66_2 Ubiquitin-like protein ISG15 (chains C, D)
SHHHHHHMGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVA
LQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSG
LEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Primary citation

The Structure of the complex of ISG15 and Influenza B virus NS1 Protein: implications for the mechanism of SN1-mediated inhibition of ISG15 conjugation. Guan, R., Ma, L.C., Leonard, P.G. et al. To be published.

Other PDB entries of the same protein (UniProt P03502 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S8S 1.87 Å, Crystal Structure of HLA A*1101 in complex with RVLVNGTFLK, an 10-mer epitope from…
3RT3 2.01 Å, Complex of influenza virus protein with host anti-viral factor
1XEQ 2.1 Å, Crystal tructure of RNA binding domain of influenza B virus non-structural protein
3SDL 2.29 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B…
6JH0 2.4 Å, Crystal structure of cISG15/NS1B complex
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex
6JH1 3.0 Å, Crystal structure of bISG15/NS1B complex

Browse structure collections

About this viewer

MolViewer shows 3R66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.