3RT3: Ubiquitin-like protein ISG15

Complex of influenza virus protein with host anti-viral factor. Determined by X-ray diffraction at 2.01 Å resolution. Released 13 Jul 2011.

Method: X-ray diffraction
Resolution: 2.01 Å
Organisms: Homo sapiens, Influenza B virus
Chains: 2
Atoms: 2,051
Mol. weight: 30.31 kDa
Ligands: SIN
Released: 13 Jul 2011

Explore 3RT3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RT3 contains 15 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	14-18	5	1
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-48	6	1
α-helix	52	1
β-strand	53	1	1
α-helix	54-55	2
α-helix	60-63	4
β-strand	70-75	6	1
β-strand	82-87	6	2
β-strand	93-98	6	2
β-strand	103	1	3
α-helix	104-115	12
α-helix	119-121	3
β-strand	122-126	5	2
β-strand	129-130	2	2
α-helix	131-132	2
β-strand	136	1	3
α-helix	137-140	4
β-strand	147-152	6	2
α-helix	153-154	2

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	16-36	21
α-helix	42-63	22
α-helix	68-70	3
α-helix	74-90	17
α-helix	93-100	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein ISG15	B	protein	159	Homo sapiens	P05161 (AlphaFold model)
Non-structural protein 1	C	protein	109	Influenza B virus	P03502 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3RT3_1 Ubiquitin-like protein ISG15 (chains B)
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKSDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGR

Sequence of entity 2 (C), FASTA

>3RT3_2 Non-structural protein 1 (chains C)
MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIK
THNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
SIN	Succinic acid	C4 H6 O4	2

Primary citation

Crystal structure of human ISG15 in complex with influenza B virus NS1B. Li, L., Wang, X.Q. To be published.

Other PDB entries of the same protein (UniProt P05161 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FFA 1.5 Å, FMDV Leader protease bound to substrate ISG15
3PHX 1.6 Å, OTU Domain of Crimean Congo Hemorrhagic Fever Virus in complex with ISG15
7S6P 2.15 Å, The crystal structure of human ISG15
3SDL 2.29 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza B…
6BI8 2.29 Å, X-ray structure of MERS coronavirus papain-like protease in complex with human ISG15
3PSE 2.3 Å, Structure of a viral OTU domain protease bound to interferon-stimulated gene 15 (ISG15)
3R66 2.3 Å, Crystal structure of human ISG15 in complex with NS1 N-terminal region from influenza…
5W8U 2.41 Å, Crystal structure of MERS-CoV papain-like protease in complex with the C-terminal domain…
1Z2M 2.5 Å, Crystal Structure of ISG15, the Interferon-Induced Ubiquitin Cross Reactive Protein
9NN9 2.59 Å, ISG15 complexed with nanobody
5TL6 2.62 Å, Crystal structure of SARS-CoV papain-like protease in complex with the C-terminal domain…
9LW4 2.7 Å, UbCh8-ISG15 complex

Browse structure collections

About this viewer

MolViewer shows 3RT3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.