3R6L: Caspase-2 T380A

Caspase-2 T380A bound with Ac-VDVAD-CHO. Determined by X-ray diffraction at 1.9 Å resolution. Released 27 Jul 2011.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,489
Mol. weight: 63.02 kDa
Released: 27 Jul 2011

Explore 3R6L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R6L contains 22 α-helices and 40 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	177-180	4
α-helix	181-187	7
α-helix	188-190	3
β-strand	191	1	1
β-strand	200-206	7	2
α-helix	222-235	14
β-strand	238-244	7	2
α-helix	248-259	12
α-helix	262-265	4
β-strand	269-275	7	2
β-strand	278-279	2	3
β-strand	282-284	3	3
β-strand	290-292	3	3
α-helix	293-299	7
α-helix	306-308	3
β-strand	313-318	6	2
β-strand	324	1	4
β-strand	326	1	5
β-strand	329-330	2	6

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	357-358	2	7
β-strand	364-368	5	2
β-strand	374	1	4
α-helix	375-376	2
β-strand	377-379	3	8
β-strand	383-384	2	8
α-helix	385-397	13
α-helix	403-416	14
β-strand	430	1	5
β-strand	434-437	4	2
β-strand	442	1	1

Chain C: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	177-180	4
α-helix	181-187	7
α-helix	188-190	3
β-strand	191	1	9
β-strand	200-206	7	2
α-helix	222-235	14
β-strand	238-244	7	2
α-helix	248-259	12
α-helix	262-266	5
β-strand	269-275	7	2
β-strand	278-279	2	10
β-strand	282-284	3	10
β-strand	290-292	3	10
α-helix	293-299	7
α-helix	306-308	3
β-strand	313-318	6	2
β-strand	324	1	11
β-strand	326	1	12
β-strand	329-330	2	7
α-helix	331-332	2

Chain D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	357-358	2	6
β-strand	364-368	5	2
β-strand	374	1	11
β-strand	377-379	3	13
β-strand	383-384	2	13
α-helix	385-397	13
α-helix	403-416	14
β-strand	430	1	12
β-strand	434-437	4	2
β-strand	442	1	9

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	403-405	3	8

Chain F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	404-405	2	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-2 subunit p18	A, C	protein	160	Homo sapiens	P42575 (AlphaFold model)
Caspase-2 subunit p12	B, D	protein	112	Homo sapiens	P42575 (AlphaFold model)
Peptide Inhibitor (ACE)VDVAD-CHO	E, F	protein	6

Sequence of entity 1 (A, C), FASTA

>3R6L_1 Caspase-2 subunit p18 (chains A, C)
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLF
KLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQL
QEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQD

Sequence of entity 2 (B, D), FASTA

>3R6L_2 Caspase-2 subunit p12 (chains B, D)
GKEKLPKMRLPTRSDMICGYACLKGTAAMRNAKRGSWYIEALAQVFSERACDMHVADMLV
KVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPTLEHHHHHH

Sequence of entity 3 (E, F), FASTA

>3R6L_3 Peptide Inhibitor (ACE)VDVAD-CHO (chains E, F)
XVDVAD

Primary citation

Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis. Tang, Y., Wells, J.A., Arkin, M.R. J Biol Chem (2011) 286:34147-34154. DOI 10.1074/jbc.M111.247627 · PubMed

Other PDB entries of the same protein (UniProt P42575 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y8D 1.51 Å, 14-3-3 Sigma in complex with phosphorylated caspase{pS164} peptide
8VP4 1.51 Å, Crystal Structure of JF1cpCasp2 with Peptide Inhibitor AcVDVAD-CHO
6Y8B 1.54 Å, 14-3-3 Sigma in complex with phosphorylated caspase{pS139} peptide
6S9K 1.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding…
1PYO 1.65 Å, Crystal Structure of Human Caspase-2 in Complex with Acetyl-Leu-Asp-Glu-Ser-Asp-cho
3R5J 1.77 Å, Crystal structure of active caspase-2 bound with Ac-ADVAD-CHO
3R7B 1.8 Å, Caspase-2 bound to one copy of Ac-DVAD-CHO
9C2Y 1.96 Å, Crystal Structure of JF1cpCasp2 in complex with MUR-65
3R6G 2.07 Å, Crystal structure of active caspase-2 bound with Ac-VDVAD-CHO
3R7S 2.25 Å, Crystal Structure of Apo Caspase2
3R7N 2.33 Å, Caspase-2 bound with two copies of Ac-DVAD-CHO
3RJM 2.55 Å, CASPASE2 in complex with chdi ligand 33c

Browse structure collections

About this viewer

MolViewer shows 3R6L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.