3RAN: Canine GDP-ran Q69L mutant

Canine GDP-ran Q69L mutant. Determined by X-ray diffraction at 2.15 Å resolution. Released 2 Dec 1998.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Canis lupus familiaris
Chains: 4
Atoms: 6,829
Mol. weight: 99.63 kDa
Ligands: GDP, MG
Released: 2 Dec 1998

Explore 3RAN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RAN contains 49 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
α-helix	23-28	6
β-strand	30	1	2
α-helix	31-35	5
β-strand	38-40	3	1
α-helix	41-43	3
β-strand	45-54	10	1
β-strand	57-66	10	1
α-helix	77-80	4
β-strand	85-91	7	1
α-helix	95-99	5
α-helix	101-112	12
β-strand	117-122	6	1
α-helix	133-135	3
β-strand	145-149	5	1
β-strand	150	1	3
β-strand	155	1	3
α-helix	159-169	11
β-strand	176-178	3	1
α-helix	179-181	3
β-strand	182	1	2
α-helix	183-185	3
α-helix	191-204	14

Chain B: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-16	7	4
α-helix	23-27	5
β-strand	30	1	5
α-helix	31-35	5
β-strand	38-40	3	4
β-strand	45-54	10	4
β-strand	57-66	10	4
α-helix	70-71	2
α-helix	77-80	4
β-strand	85-91	7	4
α-helix	95-111	17
β-strand	117-122	6	4
α-helix	133-135	3
β-strand	144-149	6	4
β-strand	150	1	6
α-helix	151-153	3
β-strand	155	1	6
α-helix	158-169	12
β-strand	176-178	3	4
α-helix	179-181	3
β-strand	182	1	5
α-helix	183-185	3
α-helix	191-204	14

Chain C: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-16	7	7
α-helix	23-27	5
β-strand	30	1	8
α-helix	31-35	5
β-strand	38-40	3	7
α-helix	41-43	3
β-strand	45-54	10	7
β-strand	57-66	10	7
α-helix	70-71	2
α-helix	77-80	4
β-strand	85-91	7	7
α-helix	95-99	5
α-helix	101-112	12
β-strand	117-122	6	7
α-helix	133-138	6
β-strand	144-148	5	7
β-strand	150	1	9
α-helix	151-153	3
β-strand	155	1	9
α-helix	159-169	11
β-strand	176-178	3	7
α-helix	179-181	3
β-strand	182	1	8
α-helix	191-205	15

Chain D: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-16	7	10
α-helix	23-28	6
β-strand	30	1	11
α-helix	31-35	5
β-strand	38-40	3	10
α-helix	41-43	3
β-strand	45-54	10	10
β-strand	57-66	10	10
α-helix	77-80	4
β-strand	85-91	7	10
α-helix	95-99	5
α-helix	101-111	11
β-strand	117-122	6	10
α-helix	133-136	4
β-strand	144-148	5	10
β-strand	150	1	12
α-helix	151-153	3
β-strand	155	1	12
α-helix	159-169	11
β-strand	176-178	3	10
α-helix	179-181	3
β-strand	182	1	11
α-helix	183-185	3
α-helix	191-205	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (GTP-binding nuclear protein ran)	A, B, C, D	protein	216	Canis lupus familiaris	P62825 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3RAN_1 PROTEIN (GTP-BINDING NUCLEAR PROTEIN RAN) (chains A, B, C, D)
MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIK
FNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC
GNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMP
ALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	4
MG	Magnesium ion	Mg	4

Primary citation

The structure of the Q69L mutant of GDP-Ran shows a major conformational change in the switch II loop that accounts for its failure to bind nuclear transport factor 2 (NTF2). Stewart, M., Kent, H.M., McCoy, A.J. J Mol Biol (1998) 284:1517-1527. DOI 10.1006/jmbi.1998.2204 · PubMed

Other PDB entries of the same protein (UniProt P62825 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA5 2.0 Å, Structure of the Cse1:Imp-alpha:RanGTP complex
1BYU 2.15 Å, Canine GDP-ran
1QG2 2.5 Å, Canine GDP-ran R76E mutant
1QG4 2.5 Å, Canine GDP-ran F72Y mutant
5BXQ 2.5 Å, Structure of the NTF2:RanGDP complex
2BKU 2.7 Å, Kap95p:RanGTP complex
3W3Z 2.7 Å, Crystal structure of Kap121p bound to RanGTP
3A6P 2.92 Å, Crystal structure of Exportin-5:RanGTP:pre-miRNA complex
5YU6 3.0 Å, Crystal structure of exportin-5:RANGTP complex

Browse structure collections

About this viewer

MolViewer shows 3RAN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.