Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering. Determined by X-ray diffraction at 1.7 Å resolution. Released 14 Mar 2012.
Explore 3RFS in 3D Show helices and sheets RCSB PDB PDBe
3RFS contains 18 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-8 | 2 | 1 |
| α-helix | 9-12 | 4 | |
| α-helix | 16-26 | 11 | |
| β-strand | 34-35 | 2 | 1 |
| α-helix | 37-40 | 4 | |
| β-strand | 45-47 | 3 | 2 |
| α-helix | 59-61 | 3 | |
| β-strand | 67-69 | 3 | 2 |
| α-helix | 79-81 | 3 | |
| β-strand | 89-91 | 3 | 2 |
| β-strand | 113-115 | 3 | 2 |
| β-strand | 137-139 | 3 | 2 |
| β-strand | 161-163 | 3 | 2 |
| β-strand | 185-187 | 3 | 2 |
| β-strand | 209-211 | 3 | 2 |
| β-strand | 217 | 1 | 3 |
| α-helix | 225-233 | 9 | |
| α-helix | 235-237 | 3 | |
| β-strand | 238 | 1 | 2 |
| β-strand | 239 | 1 | 4 |
| β-strand | 245 | 1 | 4 |
| α-helix | 247-249 | 3 | |
| β-strand | 251 | 1 | 5 |
| β-strand | 252 | 1 | 3 |
| β-strand | 258 | 1 | 5 |
| α-helix | 259-261 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-8 | 2 | 6 |
| α-helix | 9-12 | 4 | |
| α-helix | 16-26 | 11 | |
| β-strand | 34-35 | 2 | 6 |
| α-helix | 37-40 | 4 | |
| β-strand | 45-47 | 3 | 7 |
| α-helix | 59-61 | 3 | |
| β-strand | 67-69 | 3 | 7 |
| α-helix | 79-83 | 5 | |
| β-strand | 89-91 | 3 | 7 |
| β-strand | 113-115 | 3 | 7 |
| β-strand | 137-139 | 3 | 7 |
| β-strand | 161-163 | 3 | 7 |
| β-strand | 185-187 | 3 | 7 |
| β-strand | 209-211 | 3 | 7 |
| β-strand | 217 | 1 | 8 |
| α-helix | 225-233 | 9 | |
| α-helix | 235-237 | 3 | |
| β-strand | 238 | 1 | 7 |
| β-strand | 239 | 1 | 9 |
| β-strand | 245 | 1 | 9 |
| α-helix | 247-249 | 3 | |
| β-strand | 251 | 1 | 10 |
| β-strand | 252 | 1 | 8 |
| β-strand | 258 | 1 | 10 |
| α-helix | 259-261 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Internalin B, repeat modules, Variable lymphocyte receptor B | A, B | protein | 272 | Listeria monocytogenes, Eptatretus burgeri, synthetic | Q4G1L3 (AlphaFold model) |
>3RFS_1 Internalin B, repeat modules, Variable lymphocyte receptor B (chains A, B) ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQ YLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQ LQSLPDGVFDKLTNLTYLNLAHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKL TQLKDLRLYQNQLKSVPDGVFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVRN SAGSVAPDSAKCSGSGKPVRSIICPTHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering. Lee, S.C., Park, K., Han, J. et al. Proc Natl Acad Sci U S A (2012) 109:3299-3304. DOI 10.1073/pnas.1113193109 · PubMed
Other PDB entries of the same protein (UniProt Q4G1L3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3RFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.