3RK3: Truncated SNARE complex with complexin

Truncated SNARE complex with complexin. Determined by X-ray diffraction at 3.5 Å resolution. Released 27 Jul 2011.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Homo sapiens, Rattus norvegicus
Chains: 5
Atoms: 2,215
Mol. weight: 35.97 kDa
Released: 27 Jul 2011

Explore 3RK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RK3 contains 5 α-helices and 0 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	28-59	32

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	190-246	57

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-73	63

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	140-202	63

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	29-70	42

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vamp2	A	protein	37	Homo sapiens	P63027 (AlphaFold model)
Syntaxin 1a	B	protein	65	Rattus norvegicus	P32851 (AlphaFold model)
SNAP25	C	protein	81	Homo sapiens	P60880 (AlphaFold model)
SNAP25	D	protein	65	Homo sapiens	P60880 (AlphaFold model)
Complexin-1	E	protein	63	Homo sapiens	O14810 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RK3_1 Vamp2 (chains A)
GPLGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL

Sequence of entity 2 (B), FASTA

>3RK3_2 Syntaxin 1a (chains B)
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAV
SDTKK

Sequence of entity 3 (C), FASTA

>3RK3_3 SNAP25 (chains C)
GSHMMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEE
GMNHINQDMKEAEKNLKDLGW

Sequence of entity 4 (D), FASTA

>3RK3_4 SNAP25 (chains D)
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQR
ATKML

Sequence of entity 5 (E), FASTA

>3RK3_5 Complexin-1 (chains E)
GPLGSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREA
EAQ

Primary citation

Complexin cross-links prefusion SNAREs into a zigzag array. Kummel, D., Krishnakumar, S.S., Radoff, D.T. et al. Nat Struct Mol Biol (2011) 18:927-933. DOI 10.1038/nsmb.2101 · PubMed

Other PDB entries of the same protein (UniProt P63027 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CKX 1.98 Å, Crystal structure of Dsk2 Sti1 domain bound to a transmembrane domain
3FIE 2.1 Å, Crystal structure of Clostridium botulinum neurotoxin serotype F catalytic domain with…
3FII 2.17 Å, Crystal structure of Clostridium botulinum neurotoxin serotype F catalytic domain with…
3RK2 2.2 Å, Truncated SNARE complex
7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1
3RL0 3.8 Å, Truncated SNARE complex with complexin (P1)

Browse structure collections

About this viewer

MolViewer shows 3RK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.