7UDC: Synaptobrevin-Munc18-1-syntaxin-1 complex class1

cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1. Determined by electron microscopy at 3.7 Å resolution. Released 6 Apr 2022.

Method: Electron microscopy
Resolution: 3.7 Å
Organism: Rattus norvegicus
Chains: 3
Atoms: 6,425
Mol. weight: 104.58 kDa
Released: 6 Apr 2022

Explore 7UDC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UDC contains 41 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
β-strand	29-33	5	1
α-helix	35-44	10
α-helix	47-51	5
β-strand	55-60	6	1
β-strand	73-77	5	1
α-helix	81-90	10
β-strand	93	1	2
β-strand	96	1	2
β-strand	102-106	5	1
α-helix	109-111	3
α-helix	112-120	9
α-helix	123-126	4
β-strand	127-132	6	1
β-strand	138-139	2	3
β-strand	144-146	3	3
α-helix	152-157	6
α-helix	165-182	18
β-strand	188-191	4	3
α-helix	198-215	18
β-strand	229-233	5	3
β-strand	248	1	4
α-helix	249-256	8
β-strand	263-266	4	5
β-strand	277-280	4	5
α-helix	286-291	6
β-strand	295	1	4
α-helix	296-312	17
α-helix	328-357	30
α-helix	358-362	5
α-helix	363-374	12
β-strand	376	1	6
α-helix	381	1
β-strand	382	1	6
α-helix	383	1
α-helix	387-394	8
α-helix	401-414	14
β-strand	418	1	7
α-helix	420-430	11
α-helix	437-442	6
α-helix	443-446	4
β-strand	451	1	7
β-strand	473	1	8
α-helix	481-491	11
β-strand	501	1	3
β-strand	536-541	6	3
β-strand	545	1	9
α-helix	547-560	14
β-strand	564-569	6	3
β-strand	572	1	9
α-helix	575-582	8

Chain B: 11 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	5-11	7
α-helix	29-63	35
α-helix	69-101	33
α-helix	104-107	4
α-helix	110-148	39
α-helix	162-167	6
α-helix	179-192	14
α-helix	205-220	16
α-helix	221-223	3
α-helix	229-231	3
α-helix	233-239	7

Chain C: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	35-37	3
α-helix	38-72	35
α-helix	73-76	4
β-strand	79	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 1	A	protein	607	Rattus norvegicus	P61765 (AlphaFold model)
Syntaxin-1A	B	protein	254	Rattus norvegicus	P32851 (AlphaFold model)
Synaptobrevin-2	C	protein	59	Rattus norvegicus	P63027 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7UDC_1 Syntaxin-binding protein 1 (chains A)
GSPGISGGGGGIHMAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKM
TDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFT
DSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNP
ILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKAR
SQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDL
WIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRKLSQMLKKMPQYQKELSKYSTH
LHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRI
ILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKER
ISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKA
PGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNK
TDEEISS

Sequence of entity 2 (B), FASTA

>7UDC_2 Syntaxin-1A (chains B)
GSKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHS
AILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQ
HSTLSRKFVEVMSEYNATQSDYRERAKGRIQRQLEITGRTTTSEEAADMLESGNPAIFAS
GIIMDSSISKQALSEIETRHSEIIKCENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEH
AVDYVERAVSDTKK

Sequence of entity 3 (C), FASTA

>7UDC_3 Synaptobrevin-2 (chains C)
GSMWNRRLQQTCAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAK

Primary citation

SNARE assembly enlightened by cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex. Stepien, K.P., Xu, J., Zhang, X. et al. Sci Adv (2022) 8:eabo5272-eabo5272. DOI 10.1126/sciadv.abo5272 · PubMed

Other PDB entries of the same protein (UniProt P61765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex
4JEU 3.2 Å, Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex
7XSJ 3.2 Å, The structure of the Mint1/Munc18-1/syntaxin-1 complex
3PUJ 3.31 Å, Crystal structure of the MUNC18-1 and SYNTAXIN4 N-Peptide complex
6LPC 3.4 Å, Crystal Structure of rat Munc18-1 with K332E/K333E mutation
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2

Browse structure collections

About this viewer

MolViewer shows 7UDC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.