3RN2: Interferon-inducible protein AIM2

Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors. Determined by X-ray diffraction at 2.55 Å resolution. Released 25 Apr 2012.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,978
Mol. weight: 59.6 kDa
Released: 25 Apr 2012

Explore 3RN2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RN2 contains 12 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	148-150	3	1
β-strand	154-161	8	1
β-strand	165-169	5	2
β-strand	172-176	5	2
β-strand	177-182	6	1
β-strand	187-192	6	1
α-helix	195-197	3
β-strand	206-210	5	1
β-strand	212-214	3	1
β-strand	218-221	4	1
β-strand	226-229	4	1
α-helix	237-239	3
α-helix	240-246	7
α-helix	249-251	3
α-helix	252-255	4
α-helix	259	1
β-strand	263-275	13	3
β-strand	279-286	8	3
β-strand	289-296	8	3
α-helix	301-303	3
β-strand	309-319	11	3
β-strand	325-327	3	3
β-strand	333-337	5	3

Chain B: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	149-150	2	4
β-strand	154-161	8	4
β-strand	165-167	3	5
β-strand	174-176	3	5
β-strand	177-182	6	4
β-strand	187-192	6	4
α-helix	195-199	5
β-strand	206-210	5	4
β-strand	212-214	3	4
β-strand	219-221	3	4
β-strand	226-229	4	4
α-helix	240-247	8
α-helix	249-251	3
α-helix	252-255	4
α-helix	259	1
β-strand	263-275	13	6
β-strand	279-286	8	6
β-strand	289-296	8	6
β-strand	309-319	11	6
β-strand	325-327	3	6
β-strand	333-337	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-inducible protein AIM2	A, B	protein	208	Homo sapiens	O14862 (AlphaFold model)
DNA (5'-d(cpcpaptpcpapapapgpaptpcptptptpgpaptpgpg)-3')	K, L	DNA	20

Sequence of entity 1 (A, B), FASTA

>3RN2_1 Interferon-inducible protein AIM2 (chains A, B)
GSVDSIREGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTLLKD
KFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQP
LGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSK
NGEKLQLTSGVHSTIKVIKAKKKTAAAS

Sequence of entity 2 (K, L), FASTA

>3RN2_2 DNA (5'-D(*CP*CP*AP*TP*CP*AP*AP*AP*GP*AP*TP*CP*TP*TP*TP*GP*AP*TP*GP*G)-3') (chains K, L)
CCATCAAAGATCTTTGATGG

Primary citation

Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor. Jin, T., Perry, A., Jiang, J. et al. Immunity (2012) 36:561-571. DOI 10.1016/j.immuni.2012.02.014 · PubMed

Other PDB entries of the same protein (UniProt O14862 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O7Q 1.82 Å, Crystal Structure of the F27G AIM2 Pyrin Domain Mutant and Similarities of its…
3VD8 2.07 Å, Crystal structure of human AIM2 PYD domain with MBP fusion
3RN5 2.5 Å, Structural basis of cytosolic DNA recognition by innate immune receptors
7K3R 3.2 Å, Cryo-EM structure of AIM2-PYD filament
6MB2 5.0 Å, Cryo-EM structure of the PYD filament of AIM2

Browse structure collections

About this viewer

MolViewer shows 3RN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.