3VD8: Human AIM2 PYD domain with MBP fusion

Crystal structure of human AIM2 PYD domain with MBP fusion. Determined by X-ray diffraction at 2.07 Å resolution. Released 16 Jan 2013.

Method: X-ray diffraction
Resolution: 2.07 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 4,078
Mol. weight: 55.04 kDa
Released: 16 Jan 2013

Explore 3VD8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VD8 contains 33 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	7-10	4	1
α-helix	17-31	15
β-strand	35-38	4	1
α-helix	43-50	8
β-strand	59-63	5	1
α-helix	64-66	3
α-helix	67-72	6
β-strand	76	1	2
α-helix	77-79	3
α-helix	83-86	4
β-strand	89	1	3
α-helix	91-96	6
β-strand	98-99	2	4
β-strand	102-103	2	4
β-strand	106-111	6	1
β-strand	114-118	5	5
β-strand	128	1	6
α-helix	132-140	9
β-strand	145-147	3	5
α-helix	154-163	10
β-strand	167-172	6	7
β-strand	175-182	8	7
α-helix	186-200	15
α-helix	210-218	9
β-strand	222-227	6	5
α-helix	229-231	3
α-helix	232-237	6
β-strand	242-245	4	5
α-helix	246-248	3
β-strand	249	1	6
β-strand	250	1	8
β-strand	253	1	8
α-helix	254-255	2
α-helix	257	1
β-strand	258-259	2	9
β-strand	260-266	7	1
β-strand	267	1	2
α-helix	273-279	7
α-helix	280-284	5
α-helix	287-296	10
β-strand	301-302	2	1
β-strand	304	1	3
α-helix	305-311	7
α-helix	315-325	11
β-strand	328-329	2	9
α-helix	330-331	2
α-helix	336-351	16
α-helix	357-367	11
α-helix	1001-1007	7
α-helix	1008-1013	6
α-helix	1014-1016	3
α-helix	1019-1027	9
α-helix	1039-1042	4
α-helix	1045-1056	12
α-helix	1058-1071	14
α-helix	1075-1093	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein, Interferon-inducible protein AIM2	A	protein	489	Escherichia coli, Homo sapiens	O14862 (AlphaFold model), P0AEY0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VD8_1 Maltose-binding periplasmic protein, Interferon-inducible protein AIM2 (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAVDMESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVA
TLMIQNAGAVSAVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSAA
ALEHHHHHH

Primary citation

Structure of the Absent in Melanoma 2 (AIM2) Pyrin Domain Provides Insights into the Mechanisms of AIM2 Autoinhibition and Inflammasome Assembly. Jin, T., Perry, A., Smith, P. et al. J Biol Chem (2013) 288:13225-13235. DOI 10.1074/jbc.M113.468033 · PubMed

Other PDB entries of the same protein (UniProt O14862 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O7Q 1.82 Å, Crystal Structure of the F27G AIM2 Pyrin Domain Mutant and Similarities of its…
3RN5 2.5 Å, Structural basis of cytosolic DNA recognition by innate immune receptors
3RN2 2.55 Å, Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors
7K3R 3.2 Å, Cryo-EM structure of AIM2-PYD filament
6MB2 5.0 Å, Cryo-EM structure of the PYD filament of AIM2

Browse structure collections

About this viewer

MolViewer shows 3VD8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.