Crystal structure of the SH3 domain from IRSp53 (BAIAP2). Determined by X-ray diffraction at 1.5 Å resolution. Released 4 May 2011.
Explore 3RNJ in 3D Show helices and sheets RCSB PDB PDBe
3RNJ contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 378-381 | 4 | 1 |
| β-strand | 385 | 1 | 2 |
| β-strand | 393 | 1 | 1 |
| α-helix | 394-395 | 2 | |
| β-strand | 396 | 1 | 2 |
| β-strand | 401-404 | 4 | 1 |
| β-strand | 410 | 1 | 1 |
| β-strand | 413-418 | 6 | 1 |
| β-strand | 424-428 | 5 | 1 |
| α-helix | 429-431 | 3 | |
| β-strand | 432-434 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Brain-specific angiogenesis inhibitor 1-associated protein 2 | A | protein | 67 | Homo sapiens | Q9UQB8 (AlphaFold model) |
>3RNJ_1 Brain-specific angiogenesis inhibitor 1-associated protein 2 (chains A) GPLGSGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPF SYTRVLD
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
| EDT | {[-(bis-carboxymethyl-amino)-ethyl]-carboxymethyl-amino}-acetic acid | C10 H16 N2 O8 | 1 |
Water and common crystallization additives (EDO) are not listed.
Crystal structure of the SH3 domain from IRSp53 (BAIAP2). Simister, P.C., Barilari, M., Muniz, J.R.C. et al. To be published.
Other PDB entries of the same protein (UniProt Q9UQB8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3RNJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.