Crystal Structure of Leukotoxin (LukE) from Staphylococcus aureus subsp. aureus COL. Determined by X-ray diffraction at 3.2 Å resolution. Released 4 May 2011.
Explore 3ROH in 3D Show helices and sheets RCSB PDB PDBe
3ROH contains 3 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32-36 | 5 | 1 |
| β-strand | 39-50 | 12 | 1 |
| β-strand | 55-66 | 12 | 1 |
| β-strand | 72-83 | 12 | 1 |
| β-strand | 87-90 | 4 | 2 |
| β-strand | 99-114 | 16 | 2 |
| β-strand | 119-125 | 7 | 1 |
| β-strand | 130 | 1 | 2 |
| β-strand | 134-142 | 9 | 3 |
| β-strand | 146-150 | 5 | 3 |
| β-strand | 161-168 | 8 | 3 |
| β-strand | 172-179 | 8 | 2 |
| β-strand | 183-190 | 8 | 2 |
| β-strand | 192-194 | 3 | 4 |
| β-strand | 199-201 | 3 | 4 |
| β-strand | 209 | 1 | 5 |
| α-helix | 220-222 | 3 | |
| β-strand | 223 | 1 | 5 |
| α-helix | 226-228 | 3 | |
| α-helix | 231-234 | 4 | |
| β-strand | 236-237 | 2 | 1 |
| β-strand | 240-247 | 8 | 1 |
| β-strand | 254-273 | 20 | 2 |
| β-strand | 277-299 | 23 | 2 |
| β-strand | 304-310 | 7 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leucotoxin LukEv | A | protein | 329 | Staphylococcus aureus subsp. aureus NCTC 8325 | Q2FXB0 (AlphaFold model) |
>3ROH_1 Leucotoxin LukEv (chains A) MGSSHHHHHHENLYFQGMMFKKKMLAATLSVGLIAPLASPIQESRANTNIENIGDGAEVI KRTEDVSSKKWGVTQNVQFDFVKDKKYNKDALIVKMQGFINSRTSFSDVKGSGYELTKRM IWPFQYNIGLTTKDPNVSLINYLPKNKIETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYS KTISYTQKSYVSEVDKQNSKSVKWGVKANEFVTPDGKKSAHDRYLFVQSPNGPTGSAREY FAPDNQLPPLVQSGFNPSFITTLSHEKGSSDTSEFEISYGRNLDITYATLFPRTGIYAER KHNAFVNRNFVVRYEVNWKTHEIKVKGHN
Crystal structures of the components of the Staphylococcus aureus leukotoxin ED. Nocadello, S., Minasov, G., Shuvalova, L. et al. Acta Crystallogr D Biol Crystallogr (2016) 72:113-120. DOI 10.1107/S2059798315023207 · PubMed
Other PDB entries of the same protein (UniProt Q2FXB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ROH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.