3RYL: Protein VPA1370

Dimerization domain of Vibrio parahemolyticus VopL. Determined by X-ray diffraction at 3.1 Å resolution. Released 31 Aug 2011.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Vibrio parahaemolyticus
Chains: 2
Atoms: 3,484
Mol. weight: 54.13 kDa
Released: 31 Aug 2011

Explore 3RYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RYL contains 26 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	252-256	5
α-helix	262-278	17
α-helix	284-292	9
α-helix	297-300	4
α-helix	306-312	7
α-helix	313-316	4
α-helix	341-349	9
β-strand	360	1	1
β-strand	364	1	1
α-helix	375-384	10
α-helix	387-394	8
α-helix	398-407	10
α-helix	415-432	18
α-helix	438-440	3
α-helix	441-454	14
α-helix	462-474	13

Chain B: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	252-256	5
α-helix	262-278	17
α-helix	306-315	10
α-helix	342-346	5
β-strand	360	1	2
β-strand	363	1	2
α-helix	375-383	9
α-helix	387-394	8
α-helix	398-406	9
α-helix	410-412	3
α-helix	415-433	19
α-helix	438-440	3
α-helix	441-454	14
α-helix	462-479	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
protein VPA1370	A, B	protein	241	Vibrio parahaemolyticus	Q87GE5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3RYL_1 protein VPA1370 (chains A, B)
GHMRLLSEDLFKQSPKLSEQELDELANNLADYLFQAADIDWHQVISEKTRGLTTEEMAKS
EHRYVQAFCREILKYPDCYKSADVASPESPKSGGGSVIDVALKRLQTGRERLFTTTDEKG
NRELKKGDAILESAINAARMAISTEEKNTILSNNVKSATFEVFCELPCMDGFAEQNGKTA
FYALRAGFYSAFKNTDTAKQDITKFMKDNLQAGFSGYSYQGLTNRVAQLEAQLAALSAKL
S

Primary citation

Mechanism of actin filament nucleation by Vibrio VopL and implications for tandem W domain nucleation. Namgoong, S., Boczkowska, M., Glista, M.J. et al. Nat Struct Mol Biol (2011) 18:1060-1067. DOI 10.1038/nsmb.2109 · PubMed

Other PDB entries of the same protein (UniProt Q87GE5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SEO 2.31 Å, Crystal structure of VopL C terminal domain
4M63 2.75 Å, Crystal Structure of a Filament-Like Actin Trimer Bound to the Bacterial Effector VopL
3M1F 2.89 Å, Crosslinked complex of actin with first W domain of Vibrio parahaemolyticus VopL

Browse structure collections

About this viewer

MolViewer shows 3RYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.