3SEO: VopL C terminal domain

Crystal structure of VopL C terminal domain. Determined by X-ray diffraction at 2.31 Å resolution. Released 31 Aug 2011.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Vibrio parahaemolyticus
Chains: 2
Atoms: 3,555
Mol. weight: 53.98 kDa
Released: 31 Aug 2011

Explore 3SEO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SEO contains 36 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	10-13	4
α-helix	14-16	3
α-helix	19-36	18
α-helix	41-47	7
α-helix	54-58	5
α-helix	63-72	10
α-helix	97-105	9
β-strand	112-113	2	1
β-strand	125-126	2	1
α-helix	127-140	14
α-helix	144-151	8
α-helix	152-154	3
α-helix	155-163	9
α-helix	167-169	3
α-helix	172-176	5
α-helix	178-190	13
α-helix	198-212	15
α-helix	215-217	3
α-helix	219-237	19

Chain B: 18 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	10-13	4
α-helix	14-16	3
α-helix	19-36	18
α-helix	41-49	9
α-helix	54-58	5
α-helix	63-72	10
α-helix	76-78	3
α-helix	97-107	11
β-strand	112-116	5	2
β-strand	122-126	5	2
α-helix	127-140	14
α-helix	144-151	8
α-helix	152-154	3
α-helix	155-163	9
α-helix	167-169	3
α-helix	172-191	20
α-helix	198-211	14
α-helix	215-217	3
α-helix	219-239	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
VopL C terminal domain protein	A, B	protein	241	Vibrio parahaemolyticus	Q87GE5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SEO_1 VopL C terminal domain protein (chains A, B)
GHMRLLSEDLFKQSPKLSEQELDELANNLADYLFQAADIDWHQVISEKTRGLTTEEMAKS
EHRYVQAFCREILKYPDCYKSADVASPESPKSGGGSVIDVALKRLQTGRERLFTTTDEKG
NRELKKGDAILESAINAARMAISTEEKNTILSNNVKSATFEVFCELPCMDGFAEQNGKTA
FYALRAGFYSAFKNTDTAKQDITKFMKDNLQAGFSGYSYQGLTNRVAQLEAQLAALSAKL
S

Primary citation

Mechanism of actin filament nucleation by the bacterial effector VopL. Yu, B., Cheng, H.C., Brautigam, C.A. et al. Nat Struct Mol Biol (2011) 18:1068-1074. DOI 10.1038/nsmb.2110 · PubMed

Other PDB entries of the same protein (UniProt Q87GE5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M63 2.75 Å, Crystal Structure of a Filament-Like Actin Trimer Bound to the Bacterial Effector VopL
3M1F 2.89 Å, Crosslinked complex of actin with first W domain of Vibrio parahaemolyticus VopL
3RYL 3.1 Å, Dimerization domain of Vibrio parahemolyticus VopL

Browse structure collections

About this viewer

MolViewer shows 3SEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.