3S14: DNA-directed RNA polymerase II subunit RPB1

RNA Polymerase II Initiation Complex with a 6-nt RNA. Determined by X-ray diffraction at 2.85 Å resolution. Released 10 Aug 2011.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Saccharomyces cerevisiae S288c
Chains: 12
Atoms: 28,695
Mol. weight: 481.03 kDa
Ligands: ZN, MG
Released: 10 Aug 2011

Explore 3S14 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S14 contains 178 α-helices and 201 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 76 helices, 70 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	10	1
β-strand	11	1	1
β-strand	16-18	3	2
β-strand	21	1	3
α-helix	24-30	7
β-strand	43	1	4
β-strand	46	1	4
β-strand	82-90	9	5
α-helix	96-103	8
β-strand	106	1	6
β-strand	113	1	6
α-helix	122-127	6
α-helix	133-142	10
β-strand	147	1	7
β-strand	152	1	8
β-strand	162	1	8
β-strand	170	1	7
α-helix	171-172	2
β-strand	173-177	5	9
β-strand	180-184	5	9
α-helix	200	1
β-strand	201-202	2	9
α-helix	203	1
α-helix	204-213	10
α-helix	216-221	6
β-strand	225	1	10
β-strand	229	1	10
α-helix	231-234	4
β-strand	236-241	6	5
α-helix	244-246	3
α-helix	261-280	20
α-helix	290-304	15
α-helix	325-329	5
α-helix	337-341	5
β-strand	343-345	3	11
β-strand	348-355	8	12
β-strand	363-367	5	12
α-helix	368-373	6
β-strand	375-379	5	13
α-helix	385-394	10
β-strand	402-406	5	13
α-helix	408-410	3
β-strand	412-413	2	13
α-helix	419-422	4
β-strand	431-435	5	13
α-helix	436	1
β-strand	441-445	5	12
α-helix	452-454	3
β-strand	455-463	9	12
β-strand	468-470	3	12
α-helix	472-474	3
α-helix	475-478	4
β-strand	486-490	5	12
α-helix	495-500	6
α-helix	501-505	5
β-strand	506	1	12
α-helix	508-510	3
β-strand	512-513	2	14
β-strand	518-519	2	14
α-helix	525-535	11
β-strand	540-541	2	15
α-helix	543-551	9
α-helix	559-563	5
β-strand	565	1	16
β-strand	571	1	16
β-strand	572-573	2	15
α-helix	574-578	5
α-helix	583	1
β-strand	588-589	2	17
β-strand	606-608	3	17
β-strand	611-614	4	17
α-helix	619-622	4
α-helix	629-636	8
α-helix	639-660	22
α-helix	666-669	4
α-helix	673-697	25
α-helix	702-705	4
α-helix	710-736	27
α-helix	742-749	8
α-helix	755-762	8
β-strand	766-767	2	18
β-strand	770	1	19
β-strand	773	1	19
β-strand	779	1	20
β-strand	782	1	20
β-strand	799-800	2	18
α-helix	810-845	36
β-strand	849-850	2	21
β-strand	856-857	2	21
β-strand	863-865	3	21
α-helix	868-870	3
β-strand	873	1	22
α-helix	875-877	3
β-strand	879-882	4	23
α-helix	890-897	8
α-helix	910-912	3
β-strand	913	1	24
α-helix	916-919	4
α-helix	924-946	23
β-strand	953-956	4	23
α-helix	960-971	12
α-helix	978	1
β-strand	979	1	24
α-helix	983-994	12
α-helix	1005-1014	10
α-helix	1016-1025	10
α-helix	1028-1029	2
α-helix	1030-1035	6
α-helix	1039-1056	18
β-strand	1057	1	22
α-helix	1058-1059	2
α-helix	1064-1077	14
α-helix	1090-1092	3
α-helix	1097-1105	9
β-strand	1116-1119	4	25
β-strand	1120	1	26
α-helix	1121	1
α-helix	1128-1138	11
β-strand	1141-1142	2	27
β-strand	1147-1154	8	28
α-helix	1167-1171	5
β-strand	1191-1197	7	28
α-helix	1199-1204	6
α-helix	1209-1220	12
β-strand	1224-1228	5	28
β-strand	1236-1242	7	28
α-helix	1257-1269	13
β-strand	1272-1274	3	27
β-strand	1281-1287	7	25
β-strand	1290-1292	3	29
β-strand	1298-1300	3	29
β-strand	1303-1309	7	25
α-helix	1313-1316	4
β-strand	1322	1	26
β-strand	1328-1329	2	25
α-helix	1332-1339	8
α-helix	1341-1358	18
α-helix	1365-1376	12
α-helix	1389-1391	3
α-helix	1396-1399	4
α-helix	1405-1414	10
β-strand	1418-1419	2	2
α-helix	1424-1430	7
α-helix	1437-1439	3
β-strand	1442-1444	3	30

Chain B: 57 helices, 74 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	31
α-helix	25	1
α-helix	30-39	10
α-helix	45-53	9
α-helix	54-58	5
α-helix	59-63	5
β-strand	90-97	8	32
α-helix	98-100	3
β-strand	101-103	3	33
β-strand	109-111	3	33
α-helix	114-120	7
β-strand	125-134	10	32
β-strand	165-171	7	32
α-helix	172-173	2
α-helix	180-183	4
α-helix	186-191	6
β-strand	203-205	3	34
β-strand	208-210	3	34
β-strand	211	1	35
α-helix	212-213	2
β-strand	214-218	5	36
β-strand	224-227	4	37
α-helix	228-229	2
β-strand	234-242	9	37
β-strand	252-259	8	37
β-strand	269-271	3	37
α-helix	279	1
β-strand	280-281	2	37
α-helix	282-288	7
α-helix	294-299	6
α-helix	308-321	14
α-helix	327-333	7
α-helix	347-358	12
α-helix	372-389	18
α-helix	394-396	3
α-helix	401-403	3
β-strand	404-407	4	36
α-helix	409-434	26
α-helix	451-462	12
α-helix	474-476	3
β-strand	481	1	35
α-helix	488-494	7
β-strand	497-499	3	36
α-helix	516-518	3
β-strand	522	1	38
β-strand	533	1	36
β-strand	536-538	3	36
β-strand	539	1	38
β-strand	544-545	2	39
α-helix	552-560	9
β-strand	564-565	2	40
α-helix	566-568	3
α-helix	571-573	3
β-strand	578-582	5	40
β-strand	585-590	6	40
α-helix	593-606	14
β-strand	614-618	5	40
β-strand	623-627	5	40
β-strand	633-639	7	39
β-strand	640-643	4	41
β-strand	645-651	7	41
β-strand	654	1	31
α-helix	655-666	12
α-helix	681-686	6
β-strand	690-694	5	39
α-helix	695-698	4
β-strand	703-704	2	39
α-helix	708-710	3
α-helix	728-729	2
β-strand	740-741	2	39
α-helix	745-748	4
α-helix	752-755	4
α-helix	759-761	3
α-helix	764-773	10
β-strand	777	1	42
β-strand	779	1	43
α-helix	785-787	3
β-strand	793-796	4	43
β-strand	800	1	44
β-strand	804-805	2	45
α-helix	807-809	3
β-strand	821-827	7	46
β-strand	838-842	5	46
α-helix	843-847	5
β-strand	853-862	10	43
β-strand	873-874	2	47
β-strand	898	1	48
α-helix	899-900	2
β-strand	904-905	2	43
β-strand	910-912	3	48
β-strand	914-917	4	47
β-strand	934-936	3	47
β-strand	939-940	2	48
β-strand	947-956	10	43
β-strand	962-972	11	43
α-helix	973-974	2
β-strand	979-982	4	46
β-strand	987-994	8	46
β-strand	1001	1	49
β-strand	1010-1012	3	46
α-helix	1014-1016	3
α-helix	1023-1038	16
β-strand	1042-1043	2	45
α-helix	1052-1060	9
β-strand	1069-1070	2	46
β-strand	1073	1	49
α-helix	1079	1
β-strand	1080	1	49
α-helix	1081	1
α-helix	1084	1
β-strand	1085-1094	10	46
β-strand	1095	1	42
α-helix	1099-1101	3
β-strand	1104-1106	3	12
β-strand	1111	1	50
β-strand	1118	1	50
α-helix	1119	1
α-helix	1122-1124	3
α-helix	1126-1127	2
β-strand	1128-1130	3	11
α-helix	1132-1141	10
α-helix	1144-1151	8
β-strand	1158-1163	6	1
β-strand	1174	1	51
β-strand	1179	1	51
β-strand	1182	1	52
β-strand	1187	1	52
β-strand	1191-1196	6	1
α-helix	1198-1209	12
β-strand	1212	1	3
β-strand	1215-1217	3	2

Chain C: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	53
β-strand	17-23	7	53
α-helix	27-39	13
β-strand	43-54	12	54
α-helix	60-68	9
β-strand	72	1	55
α-helix	77-79	3
α-helix	83-85	3
β-strand	97-104	8	54
β-strand	111-114	4	56
α-helix	115-117	3
β-strand	119-120	2	54
α-helix	131	1
β-strand	132	1	55
α-helix	133	1
β-strand	143-147	5	56
β-strand	152-162	11	54
α-helix	168-170	3
β-strand	176-180	5	53
α-helix	197-200	4
α-helix	202-204	3
α-helix	205-209	5
β-strand	228-233	6	53
α-helix	240-265	26

Chain E: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	5-25	21
β-strand	28	1	57
α-helix	32-35	4
α-helix	39-46	8
β-strand	47	1	58
β-strand	53	1	58
α-helix	55-58	4
β-strand	61-62	2	59
β-strand	64	1	57
α-helix	66-71	6
β-strand	78-82	5	59
β-strand	87-88	2	60
α-helix	90-102	13
β-strand	107-111	5	59
β-strand	115-116	2	60
α-helix	118-121	4
β-strand	131-134	4	59
α-helix	137-140	4
α-helix	144-146	3
α-helix	151	1
β-strand	152-155	4	61
α-helix	158-167	10
α-helix	172-174	3
β-strand	177-178	2	61
α-helix	183-188	6
α-helix	190-191	2
β-strand	195-202	8	61
β-strand	206-214	9	61

Chain F: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	84	1	62
α-helix	85-86	2
α-helix	87-102	16
α-helix	105-107	3
α-helix	117-126	10
β-strand	133-137	5	30
β-strand	143-147	5	30
β-strand	152	1	62

Chain H: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	16
β-strand	23-30	8	16
β-strand	37-43	7	16
β-strand	54-60	7	16
α-helix	79-81	3
β-strand	95-98	4	16
β-strand	100-106	7	16
β-strand	112-118	7	16
β-strand	121-127	7	16
β-strand	141-145	5	16

Chain I: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	63
α-helix	12	1
β-strand	13	1	63
α-helix	14	1
β-strand	15-18	4	64
β-strand	25-28	4	64
β-strand	35-37	3	64
β-strand	44-45	2	28
α-helix	60-64	5
α-helix	73-75	3
β-strand	83-87	5	65
β-strand	99-103	5	65
β-strand	109-111	3	65

Chain J: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	18-26	9
α-helix	32-38	7
α-helix	44-51	8
β-strand	53	1	44
α-helix	57-60	4

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1733	Saccharomyces cerevisiae S288c	P04050 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB2	B	protein	1224	Saccharomyces cerevisiae S288c	P08518 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	318	Saccharomyces cerevisiae S288c	P16370 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC1	E	protein	215	Saccharomyces cerevisiae S288c	P20434 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	155	Saccharomyces cerevisiae S288c	P20435
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	146	Saccharomyces cerevisiae S288c	P20436
DNA-directed RNA polymerase II subunit RPB9	I	protein	122	Saccharomyces cerevisiae S288c	P27999
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	70	Saccharomyces cerevisiae S288c	P22139
DNA-directed RNA polymerase II subunit RPB11	K	protein	120	Saccharomyces cerevisiae S288c	P38902
DNA-directed RNA polymerases I, II, and III subunit RPABC4	L	protein	70	Saccharomyces cerevisiae S288c	P40422
RNA (5'-r(gpapgpapgpg)-3')	R	RNA	6
DNA (5'-d(cptpapcpcpgpaptpapapgpcpapgpapcpgpaptpcpcptpcptpcpgpaptp*g)-3…	T	DNA	29

Sequence of entity 1 (A), FASTA

>3S14_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGS
IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNE
LMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLK
LVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHV
ATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLE
LDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKR
AGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTF
IELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSP
KDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHN
GFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFV
DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR
LVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVD
LLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCC
LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT
LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH
TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHML
KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP
GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG
LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGS
NDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Sequence of entity 2 (B), FASTA

>3S14_2 DNA-directed RNA polymerase II subunit RPB2 (chains B)
MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQ
DIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLR
NLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCY
LSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEH
ICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEF
LPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTL
FKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETL
RTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAK
LMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIA
PGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKK
LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF

Sequence of entity 3 (C), FASTA

>3S14_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
SNASQMGNTGSGGYDNAW

Sequence of entity 4 (E), FASTA

>3S14_4 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E)
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSF
QANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Sequence of entity 5 (F), FASTA

>3S14_5 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Sequence of entity 6 (H), FASTA

>3S14_6 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR

Sequence of entity 7 (I), FASTA

>3S14_7 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS

Sequence of entity 8 (J), FASTA

>3S14_8 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD

Sequence of entity 9 (K), FASTA

>3S14_9 DNA-directed RNA polymerase II subunit RPB11 (chains K)
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA
YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

Sequence of entity 10 (L), FASTA

>3S14_10 DNA-directed RNA polymerases I, II, and III subunit RPABC4 (chains L)
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKAR
TKRLVQFEAR

Sequence of entity 11 (R), FASTA

>3S14_11 RNA (5'-R(*GP*AP*GP*AP*GP*G)-3') (chains R)
GAGAGG

Sequence of entity 12 (T), FASTA

>3S14_12 DNA (5'-D(*CP*TP*AP*CP*CP*GP*AP*TP*AP*AP*GP*CP*AP*GP*AP*CP*GP*AP*TP*CP*CP*TP*CP*TP*CP*GP*AP*TP*G)-3') (chains T)
CTACCGATAAGCAGACGATCCTCTCGATG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8
MG	Magnesium ion	Mg	1

Primary citation

Initiation complex structure and promoter proofreading. Liu, X., Bushnell, D.A., Silva, D.A. et al. Science (2011) 333:633-637. DOI 10.1126/science.1206629 · PubMed

Other PDB entries of the same protein (UniProt P04050 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
9SV6 1.96 Å, CryoEM structure of transcribing RNA polymerase II elongation complex with ATP and Elf1
5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
9W8V 2.23 Å, Structure of post-translocation state of yeast Pol II complexed with a cisplatin-induced…
9QEB 2.26 Å, CryoEM structure of transcribing RNA polymerase II elongation complex
1TWF 2.3 Å, RNA polymerase II complexed with UTP at 2.3 A resolution
9RYB 2.33 Å, CryoEM structure of transcribing RNA polymerase II elongation complex in post-catalysis…
9KD8 2.46 Å, The structure of RNA polymerase II elongation complex paused at N-2 state by actinomycin…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
9K7F 2.5 Å, RNA polymerase II elongation complex apo structure.
30ES 2.54 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…
30EP 2.55 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…

Browse structure collections

About this viewer

MolViewer shows 3S14 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.