3S5F: Human frataxin variant W155F

Crystal structure of human frataxin variant W155F. Determined by X-ray diffraction at 1.5 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,087
Mol. weight: 28.36 kDa
Ligands: MG
Released: 29 Jun 2011

Explore 3S5F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S5F contains 7 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	92-113	22
β-strand	124-128	5	1
β-strand	131-135	5	1
β-strand	142-148	7	1
β-strand	153-158	6	1
β-strand	162-168	7	1
β-strand	173-175	3	1
β-strand	181	1	1
α-helix	182-194	13

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	87-89	3
α-helix	92-112	21
α-helix	113-115	3
β-strand	124-128	5	2
β-strand	131-135	5	2
β-strand	142-148	7	2
α-helix	149-151	3
β-strand	153-158	6	2
β-strand	162-168	7	2
β-strand	173-174	2	2
β-strand	181	1	2
α-helix	182-194	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Frataxin, mitochondrial	A, B	protein	129	Homo sapiens	Q16595 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3S5F_1 Frataxin, mitochondrial (chains A, B)
GTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLG
TYVINKQTPNKQIFLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLS
SLAYSGKDA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Friedreich's Ataxia Variants I154F and W155R Diminish Frataxin-Based Activation of the Iron-Sulfur Cluster Assembly Complex. Tsai, C.L., Bridwell-Rabb, J., Barondeau, D.P. Biochemistry (2011) 50:6478-6487. DOI 10.1021/bi200666h · PubMed

Other PDB entries of the same protein (UniProt Q16595 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3T3L 1.15 Å, 1.15 A structure of human frataxin variant Q153A
3T3K 1.24 Å, 1.24 A Structure of Friedreich's ataxia frataxin variant Q148R
3S4M 1.3 Å, Crystal structure of wild-type human frataxin
3S5E 1.31 Å, Crystal structure of human frataxin variant W155R, one of the Friedreich's ataxia point…
3T3T 1.38 Å, 1.38 A structure of human frataxin variant Q148G
3S5D 1.5 Å, Crystal structure of human frataxin variant W155A
9HO5 1.5 Å, Crystal Structure of the Human Frataxin protein in complex with a tailored Camelid…
3T3X 1.57 Å, 1.57 A structure of Friedreich's ataxia frataxin variant R165C
3T3J 1.7 Å, 1.70 A structure of Friedreich's ataxia frataxin variant N146K
9HO4 1.76 Å, Crystal Structure of the Human Frataxin protein in complex with a tailored Camelid…
1EKG 1.8 Å, Mature human frataxin
9HO6 2.0 Å, Crystal Structure of the Human Frataxin protein in complex with a tailored Camelid…

Browse structure collections

About this viewer

MolViewer shows 3S5F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.