3S8S: RRM domain of human SETD1A

Crystal structure of the RRM domain of human SETD1A. Determined by X-ray diffraction at 1.3 Å resolution. Released 8 Jun 2011.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,006
Mol. weight: 12.49 kDa
Released: 8 Jun 2011

Explore 3S8S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S8S contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	95-99	5	1
α-helix	107-114	8
β-strand	120-127	8	1
β-strand	134-142	9	1
α-helix	145-155	11
β-strand	159-160	2	2
β-strand	163-164	2	2
β-strand	166-169	4	1
α-helix	174-184	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase SETD1A	A	protein	110	Homo sapiens	O15047 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3S8S_1 Histone-lysine N-methyltransferase SETD1A (chains A)
GGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTSTRG
AKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVNGSYTPQTVPTGG

Primary citation

Crystal structure of the RRM domain of human SETD1A. Chao, X., Tempel, W., Bian, C. et al. To be published.

Other PDB entries of the same protein (UniProt O15047 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EWR 1.5 Å, X-ray structure of WDR5-SETd1a Win motif peptide binary complex
8ILY 1.7 Å, Crystal structure of the RRM domain of human SETD1A
3UVN 1.79 Å, Crystal structure of WDR5 in complex with the WDR5-interacting motif of SET1A

Browse structure collections

About this viewer

MolViewer shows 3S8S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.