8ILY: RRM domain of human SETD1A

Crystal structure of the RRM domain of human SETD1A. Determined by X-ray diffraction at 1.7 Å resolution. Released 26 Apr 2023.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,024
Mol. weight: 25.28 kDa
Released: 26 Apr 2023

Explore 8ILY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ILY contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	95-99	5	1
α-helix	107-114	8
β-strand	120-127	8	1
β-strand	134-142	9	1
α-helix	145-155	11
β-strand	159-160	2	2
β-strand	163-164	2	2
β-strand	166-169	4	1
α-helix	174-184	11

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	95-99	5	3
α-helix	107-114	8
β-strand	120-127	8	3
β-strand	134-142	9	3
α-helix	145-155	11
β-strand	159-160	2	4
β-strand	163-164	2	4
β-strand	166-169	4	3
α-helix	174-185	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SET domain containing 1A, histone lysine methyltransferase	A, B	protein	110	Homo sapiens	O15047 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8ILY_1 SET domain containing 1A, histone lysine methyltransferase (chains A, B)
GHMGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTST
RGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVNGSYTPQTVPT

Primary citation

Molecular insight into the SETD1A/B N-terminal region and its interaction with WDR82. Bao, S., Xu, C. Biochem Biophys Res Commun (2023) 658:136-140. DOI 10.1016/j.bbrc.2023.03.064 · PubMed

Other PDB entries of the same protein (UniProt O15047 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S8S 1.3 Å, Crystal structure of the RRM domain of human SETD1A
4EWR 1.5 Å, X-ray structure of WDR5-SETd1a Win motif peptide binary complex
3UVN 1.79 Å, Crystal structure of WDR5 in complex with the WDR5-interacting motif of SET1A

Browse structure collections

About this viewer

MolViewer shows 8ILY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.