5H08: Human PTPRZ D1 domain

Human PTPRZ D1 domain complexed with NAZ2329. Determined by X-ray diffraction at 2.53 Å resolution. Released 26 Jul 2017.

Method: X-ray diffraction
Resolution: 2.53 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,322
Mol. weight: 34.46 kDa
Ligands: 7WL
Released: 26 Jul 2017

Explore 5H08 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H08 contains 13 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	1699-1700	2	1
α-helix	1701-1703	3
α-helix	1704-1714	11
α-helix	1717-1733	10
α-helix	1743-1746	4
α-helix	1748-1750	3
β-strand	1766	1	2
α-helix	1768-1771	4
β-strand	1785-1790	6	2
β-strand	1793-1800	8	2
α-helix	1801-1803	3
α-helix	1805-1807	3
α-helix	1808-1817	10
β-strand	1822-1825	4	2
β-strand	1830	1	3
β-strand	1835	1	3
β-strand	1846-1849	4	2
β-strand	1852-1861	10	2
β-strand	1865-1874	10	2
β-strand	1890-1896	7	2
α-helix	1908-1921	14
β-strand	1929-1932	4	2
α-helix	1938-1956	19
β-strand	1958-1959	2	1
α-helix	1961-1968	8
α-helix	1979-1993	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase zeta	A	protein	298	Homo sapiens	P23471 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5H08_1 Receptor-type tyrosine-protein phosphatase zeta (chains A)
GPAIPIKHFPKHVADLHASSGFTEEFEEVQSCTVDLGITADSSNHPDNKHKNRYINIVAY
DHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEV
IVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQ
KGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGT
YIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEV

Ligands and cofactors

ID	Name	Formula	Copies
7WL	3-{[2-Ethoxy-5-(trifluoromethyl)benzyl]sulfanyl}-N-(phenylsulfonyl)thiophene-2-…	C21 H18 F3 N O4 S3	1

Primary citation

Targeting PTPRZ inhibits stem cell-like properties and tumorigenicity in glioblastoma cells. Fujikawa, A., Sugawara, H., Tanaka, T. et al. Sci Rep (2017) 7:5609-5609. DOI 10.1038/s41598-017-05931-8 · PubMed

Other PDB entries of the same protein (UniProt P23471 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FN9 1.8 Å, Crystal structure of the C-terminal Fg domain of TNR with the single FN domain of PTPRZ
5AWX 1.86 Å, Crystal structure of Human PTPRZ D1 domain
8FN8 1.89 Å, Crystal structure of the C-terminal Fg domain of TNC with the single FN domain of PTPRZ
3JXF 2.0 Å, CA-like domain of human PTPRZ
3S97 2.3 Å, PTPRZ CNTN1 complex

Browse structure collections

About this viewer

MolViewer shows 5H08 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.