3SG6: Dimeric GCaMP2-LIA(linker 1)

Crystal Structure of Dimeric GCaMP2-LIA(linker 1). Determined by X-ray diffraction at 1.7 Å resolution. Released 20 Jun 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Gallus gallus, Aequorea victoria, Rattus norvegicus
Chains: 1
Atoms: 3,358
Mol. weight: 50.92 kDa
Ligands: CA
Released: 20 Jun 2012

Explore 3SG6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SG6 contains 17 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	41-58	18
β-strand	64-69	6	1
α-helix	70-72	3
β-strand	74-84	11	1
β-strand	85	1	2
β-strand	90-101	12	1
α-helix	110-111	2
β-strand	113-122	10	1
β-strand	131-141	11	1
α-helix	163-167	5
β-strand	170-181	12	1
β-strand	184-195	12	1
α-helix	196-198	3
β-strand	200-207	8	1
α-helix	216-219	4
α-helix	228-230	3
β-strand	232	1	1
α-helix	235-240	6
α-helix	242-245	4
β-strand	251-259	9	1
β-strand	264-274	11	1
β-strand	277-287	11	1
β-strand	300	1	2
α-helix	310-323	14
β-strand	330-331	2	3
α-helix	333-342	10
α-helix	349-357	9
β-strand	367-368	2	3
α-helix	369-377	9
α-helix	386-396	11
β-strand	403-404	2	4
α-helix	406-416	11
α-helix	422-432	11
β-strand	440-441	2	4
α-helix	442-449	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin light chain kinase, Green fluorescent protein, Calmodulin-1 chimera	A	protein	450	Gallus gallus, Aequorea victoria, Rattus norvegicus	P0DP31 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SG6_1 Myosin light chain kinase, Green fluorescent protein, Calmodulin-1 chimera (chains A)
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNKTGHAVRAIGRLSSL
IANVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSK
LSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSKGEELFTGVVPILVELDGD
VNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKQHDF
FKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEY
NTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD
GNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTD
EEVDEMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Optimization of a GCaMP calcium indicator for neural activity imaging. Akerboom, J., Chen, T.W., Wardill, T.J. et al. J Neurosci (2012) 32:13819-13840. DOI 10.1523/JNEUROSCI.2601-12.2012 · PubMed

Other PDB entries of the same protein (UniProt P0DP31 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EVU 1.75 Å, Crystal structure of Calcium bound dimeric GCAMP2
3EK7 1.85 Å, Calcium-saturated GCaMP2 dimer
3SG5 1.9 Å, Crystal Structure of Dimeric GCaMP3-D380Y, QP(linker 1), LP(linker 2)
3SG7 1.9 Å, Crystal Structure of GCaMP3-KF(linker 1)
3EKH 2.0 Å, Calcium-saturated GCaMP2 T116V/K378W mutant monomer
3SG2 2.0 Å, Crystal Structure of GCaMP2-T116V,D381Y
3SG3 2.1 Å, Crystal Structure of GCaMP3-D380Y
4I2Y 2.2 Å, Crystal Structure of the genetically encoded calcium indicator RGECO1
3SG4 2.4 Å, Crystal Structure of GCaMP3-D380Y, LP(linker 2)
3WLC 2.49 Å, Crystal structure of dimeric GCaMP6m
3EK4 2.65 Å, Calcium-saturated GCaMP2 Monomer
3WLD 2.7 Å, Crystal structure of monomeric GCaMP6m

Browse structure collections

About this viewer

MolViewer shows 3SG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.