3WLC: Dimeric GCaMP6m

Crystal structure of dimeric GCaMP6m. Determined by X-ray diffraction at 2.49 Å resolution. Released 22 Jan 2014.

Method: X-ray diffraction
Resolution: 2.49 Å
Organisms: Gallus gallus, Aequorea victoria, Rattus norvegicus
Chains: 1
Atoms: 3,288
Mol. weight: 50.56 kDa
Ligands: CA
Released: 22 Jan 2014

Explore 3WLC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WLC contains 17 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	39-56	18
β-strand	62-67	6	1
β-strand	72-82	11	1
β-strand	83	1	2
β-strand	88-99	12	1
α-helix	108-109	2
β-strand	111-120	10	1
β-strand	129-139	11	1
α-helix	161-165	5
β-strand	169-179	11	1
β-strand	182-193	12	1
β-strand	198-205	8	1
α-helix	214-216	3
α-helix	226-228	3
α-helix	229	1
β-strand	230	1	1
α-helix	231-232	2
α-helix	233-238	6
α-helix	240-243	4
β-strand	249-257	9	1
β-strand	262-272	11	1
β-strand	275-285	11	1
β-strand	298	1	2
α-helix	308-321	14
β-strand	328-329	2	3
α-helix	331-340	10
α-helix	347-355	9
β-strand	365-366	2	3
α-helix	367-375	9
α-helix	380-394	15
β-strand	402	1	4
α-helix	404-414	11
α-helix	420-430	11
β-strand	438	1	4
α-helix	440-447	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin light chain kinase, Green fluorescent protein, Calmodulin	A	protein	448	Gallus gallus, Aequorea victoria, Rattus norvegicus	P0DP31 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WLC_1 Myosin light chain kinase, Green fluorescent protein, Calmodulin (chains A)
MGSHHHHHHGMASMTGGQQMGRDLYDDDDKDLATMVDSSRRKWNKTGHAVRAIGRLSSLE
NVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLS
KDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSKGEELFTGVVPILVELDGDVN
GHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLXVQCFSRYPDHMKQHDFFK
SAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNL
PDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGD
GTIDFPEFLTMMARKGSYRDTEEEIREAFGVFDKDGNGYISAAELRHVMTNLGEKLTDEE
VDEMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Structural basis of the ultrasensitive calcium indicator GCaMP6. Ding, J., Luo, A.F., Hu, L. et al. Sci China Life Sci (2014) 57:269-274. DOI 10.1007/s11427-013-4599-5 · PubMed

Other PDB entries of the same protein (UniProt P0DP31 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SG6 1.7 Å, Crystal Structure of Dimeric GCaMP2-LIA(linker 1)
3EVU 1.75 Å, Crystal structure of Calcium bound dimeric GCAMP2
3EK7 1.85 Å, Calcium-saturated GCaMP2 dimer
3SG5 1.9 Å, Crystal Structure of Dimeric GCaMP3-D380Y, QP(linker 1), LP(linker 2)
3SG7 1.9 Å, Crystal Structure of GCaMP3-KF(linker 1)
3EKH 2.0 Å, Calcium-saturated GCaMP2 T116V/K378W mutant monomer
3SG2 2.0 Å, Crystal Structure of GCaMP2-T116V,D381Y
3SG3 2.1 Å, Crystal Structure of GCaMP3-D380Y
4I2Y 2.2 Å, Crystal Structure of the genetically encoded calcium indicator RGECO1
3SG4 2.4 Å, Crystal Structure of GCaMP3-D380Y, LP(linker 2)
3EK4 2.65 Å, Calcium-saturated GCaMP2 Monomer
3WLD 2.7 Å, Crystal structure of monomeric GCaMP6m

Browse structure collections

About this viewer

MolViewer shows 3WLC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.