Crystal Structure of Metabotropic glutamate receptor 3 precursor in presence of LY341495 antagonist. Determined by X-ray diffraction at 2.26 Å resolution. Released 27 Jul 2011.
Explore 3SM9 in 3D Show helices and sheets RCSB PDB PDBe
3SM9 contains 24 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-10 | 3 | 1 |
| β-strand | 14-20 | 7 | 1 |
| β-strand | 23-25 | 3 | 2 |
| β-strand | 32-35 | 4 | 2 |
| α-helix | 37-42 | 6 | |
| α-helix | 43-56 | 14 | |
| β-strand | 66-72 | 7 | 1 |
| α-helix | 77-89 | 13 | |
| β-strand | 117-121 | 5 | 1 |
| α-helix | 126-136 | 11 | |
| α-helix | 137-139 | 3 | |
| β-strand | 143-145 | 3 | 1 |
| α-helix | 151-154 | 4 | |
| β-strand | 162-164 | 3 | 1 |
| α-helix | 167-168 | 2 | |
| α-helix | 170-182 | 13 | |
| β-strand | 187-193 | 7 | 3 |
| α-helix | 196-210 | 15 | |
| β-strand | 215-222 | 8 | 3 |
| α-helix | 228-239 | 12 | |
| β-strand | 246-250 | 5 | 3 |
| α-helix | 253-265 | 13 | |
| β-strand | 271-274 | 4 | 3 |
| α-helix | 282-285 | 4 | |
| β-strand | 296-300 | 5 | 3 |
| α-helix | 306-313 | 8 | |
| α-helix | 326-334 | 9 | |
| β-strand | 337 | 1 | 4 |
| α-helix | 346 | 1 | |
| β-strand | 347 | 1 | 4 |
| α-helix | 348-349 | 2 | |
| α-helix | 365-386 | 22 | |
| α-helix | 395-398 | 4 | |
| α-helix | 402-404 | 3 | |
| α-helix | 405-409 | 5 | |
| α-helix | 410-412 | 3 | |
| β-strand | 415-416 | 2 | 5 |
| α-helix | 427 | 1 | |
| β-strand | 428-429 | 2 | 5 |
| β-strand | 436 | 1 | 1 |
| α-helix | 437-438 | 2 | |
| β-strand | 441-448 | 8 | 3 |
| β-strand | 453-461 | 9 | 3 |
| β-strand | 465-467 | 3 | 3 |
| α-helix | 469-471 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metabotropic glutamate receptor 3 | A | protein | 479 | Homo sapiens | Q14832 (AlphaFold model) |
>3SM9_1 Metabotropic glutamate receptor 3 (chains A) HNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYL LPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDEAEYMCPDGSYAIQENIPLLIAGV IGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEIL RFFNWTYVSTVASEGDYGETGIEAFEQEARLRNISIATAEKVGRSNIRKSYDSVIRELLQ KPNARVVVLFMRSDDSRELIAAASRANASFTWVASDGWGAQESIIKGSEHVAYGAITLEL ASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYE QESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFN PNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSYLKVGHWAETLSLDVNSIHWSRNSV
| ID | Name | Formula | Copies |
|---|---|---|---|
| Z99 | 2-[(1S,2S)-2-carboxycyclopropyl]-3-(9H-xanthen-9-yl)-D-alanine | C20 H19 N O5 | 1 |
Water and common crystallization additives (SO4, CL) are not listed.
Crystal Structure of Metabotropic glutamate receptor 3 precursor in presence of LY341495 antagonist. Wernimont, A.K., Dong, A., Seitova, A. et al. To be published.
Other PDB entries of the same protein (UniProt Q14832 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3SM9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.