3SMT: Human SET domain-containing protein3

Crystal structure of human SET domain-containing protein3. Determined by X-ray diffraction at 2.04 Å resolution. Released 20 Jul 2011.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,067
Mol. weight: 58.33 kDa
Ligands: ARS, SAM
Released: 20 Jul 2011

Explore 3SMT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SMT contains 24 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	21-34	14
α-helix	45-61	17
α-helix	74-77	4
α-helix	78-87	10
β-strand	95-100	6	1
β-strand	104-109	6	1
β-strand	113	1	2
β-strand	118-123	6	3
α-helix	124-126	3
β-strand	128-129	2	4
α-helix	130-134	5
α-helix	139-144	6
α-helix	146-150	5
α-helix	152-164	13
α-helix	172-175	4
α-helix	185-187	3
α-helix	190-194	5
α-helix	201-222	22
α-helix	240-253	14
β-strand	255-258	4	4
β-strand	265-269	5	4
α-helix	273-275	3
α-helix	276	1
β-strand	277-278	2	5
β-strand	283-288	6	3
β-strand	293-298	6	3
β-strand	302	1	2
α-helix	306	1
β-strand	307-308	2	1
β-strand	309-310	2	5
α-helix	317-324	8
β-strand	335-341	7	6
α-helix	349-358	10
β-strand	364-370	7	6
α-helix	378-387	10
α-helix	391-399	9
α-helix	419-438	20
α-helix	444-450	7
α-helix	458-489	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase setd3	A	protein	497	Homo sapiens	Q86TU7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SMT_1 Histone-lysine N-methyltransferase setd3 (chains A)
GKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIR
KKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFL
WVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPS
EYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTY
EDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQ
DFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARAG
IPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSWD
NEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKS
AAVNREYYRQQMEEKAP

Ligands and cofactors

ID	Name	Formula	Copies
ARS	Arsenic	As	2
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	1

Water and common crystallization additives (UNX, ACT, PG4) are not listed.

Primary citation

Crystal structure of human SET domain-containing protein3. Zeng, H., Dong, A., Walker, J.R. et al. To be published.

Other PDB entries of the same protein (UniProt Q86TU7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MBK 1.69 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, First…
6OX0 1.75 Å, SETD3 in Complex with an Actin Peptide with Sinefungin Replacing SAH as Cofactor
6WK2 1.76 Å, SETD3 mutant (N255V) in Complex with an Actin Peptide with His73 Replaced with Methionine
6MBJ 1.78 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, P21…
6OX3 1.78 Å, SETD3 in Complex with an Actin Peptide with His73 Replaced with Lysine
7W28 1.79 Å, Crystal Structure of SETD3-SAH in complex with betaA-4PyrAla73 peptide
6WK1 1.89 Å, SETD3 in Complex with an Actin Peptide with His73 Replaced with Methionine
6OX1 1.95 Å, SETD3 in Complex with an Actin Peptide with Target Histidine Partially Methylated
6ICT 1.95 Å, Structure of SETD3 bound to SAH and methylated actin
6V63 2.02 Å, SETD3 WT in Complex with an Actin Peptide with His73 Replaced with Glutamine
6OX2 2.09 Å, SETD3in Complex with an Actin Peptide with the Target Histidine Fully Methylated
6OX5 2.1 Å, A SETD3 Mutant (N255A) in Complex with an Actin Peptide with His73 Replaced with Lysine

Browse structure collections

About this viewer

MolViewer shows 3SMT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.