3SMZ: Human raver1 RRM1-3 domains

Human raver1 RRM1-3 domains (residues 39-320). Determined by X-ray diffraction at 1.99 Å resolution. Released 10 Aug 2011.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,452
Mol. weight: 31.78 kDa
Released: 10 Aug 2011

Explore 3SMZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SMZ contains 15 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	38-40	3
α-helix	41-56	16
β-strand	60-64	5	1
α-helix	72-78	7
β-strand	84-90	7	1
β-strand	95-100	6	1
α-helix	103-113	11
β-strand	117-118	2	2
β-strand	121-122	2	2
α-helix	123	1
β-strand	124-127	4	1
α-helix	128-129	2
β-strand	133-137	5	3
α-helix	145-152	8
α-helix	153-155	3
β-strand	158-165	8	3
β-strand	172-180	9	3
α-helix	183-193	11
β-strand	197-198	2	4
β-strand	201-202	2	4
β-strand	204-207	4	3
α-helix	210-212	3
β-strand	222-226	5	5
α-helix	228-229	2
α-helix	235-241	7
β-strand	250-255	6	5
β-strand	261-268	8	5
α-helix	272-282	11
β-strand	286-287	2	6
β-strand	290-291	2	6
β-strand	293-296	4	5
α-helix	297-298	2
α-helix	303-313	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribonucleoprotein PTB-binding 1	A	protein	284	Homo sapiens	Q8IY67 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SMZ_1 Ribonucleoprotein PTB-binding 1 (chains A)
HMLDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTA
FVTLLNGEQAEAAINAFHQSRLRERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFG
SLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPA
LLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAE
EAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNR

Primary citation

Apo raver1 structure reveals distinct RRM domain orientations. Rangarajan, E.S., Lee, J.H., Izard, T. Protein Sci (2011) 20:1464-1470. DOI 10.1002/pro.664 · PubMed

Other PDB entries of the same protein (UniProt Q8IY67 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant
3H2U 2.75 Å, Human raver1 RRM1, RRM2, and RRM3 domains in complex with human vinculin tail domain Vt
3H2V 2.9 Å, Human raver1 RRM1 domain in complex with human vinculin tail domain Vt

Browse structure collections

About this viewer

MolViewer shows 3SMZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.