3H2V: Human raver1 RRM1 domain

Human raver1 RRM1 domain in complex with human vinculin tail domain Vt. Determined by X-ray diffraction at 2.9 Å resolution. Released 28 Jul 2009.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 8
Atoms: 7,693
Mol. weight: 119 kDa
Released: 28 Jul 2009

Explore 3H2V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H2V contains 29 α-helices and 36 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	896-909	14
β-strand	912	1	1
α-helix	918-936	19
α-helix	943-971	29
β-strand	972	1	2
α-helix	975-1005	31
α-helix	1013-1043	31
β-strand	1048	1	2
β-strand	1060	1	1

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	896-909	14
β-strand	912	1	3
α-helix	918-936	19
α-helix	943-971	29
α-helix	975-1005	31
α-helix	1013-1043	31
β-strand	1060	1	3

Chain C: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	896-910	15
β-strand	912	1	4
α-helix	918-936	19
α-helix	943-971	29
α-helix	975-984	10
α-helix	987-1005	19
α-helix	1013-1043	31
β-strand	1060	1	4

Chain E: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	60-64	5	7
α-helix	72-78	7
β-strand	86-90	5	7
β-strand	95-99	5	7
α-helix	103-113	11
β-strand	117-118	2	8
β-strand	121-122	2	8
β-strand	124-127	4	7

Chains F, G and H: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	60-64	5	9
α-helix	72-78	7
β-strand	84-90	7	9
β-strand	95-100	6	9
α-helix	103-113	11
β-strand	117-118	2	10
β-strand	121-122	2	10
β-strand	124-127	4	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A, B, C, D	protein	188	Homo sapiens	P18206 (AlphaFold model)
Raver-1	E, F, G, H	protein	74	Homo sapiens	Q8IY67 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3H2V_1 Vinculin (chains A, B, C, D)
EEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVR
GGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKIL
STVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRW
VRKTPWYQ

Sequence of entity 2 (E, F, G, H), FASTA

>3H2V_2 Raver-1 (chains E, F, G, H)
HMRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQS
RLRERELSVQLQPT

Primary citation

Raver1 interactions with vinculin and RNA suggest a feed-forward pathway in directing mRNA to focal adhesions. Lee, J.H., Rangarajan, E.S., Yogesha, S.D. et al. Structure (2009) 17:833-842. DOI 10.1016/j.str.2009.04.010 · PubMed

Other PDB entries of the same protein (UniProt P18206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LN2 1.0 Å, The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
4LNP 1.41 Å, The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
3RF3 1.61 Å, Shigella IpaA-VBS3 in complex with human vinculin
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
3TJ5 1.99 Å, human vinculin head domain (Vh1, residues 1-258) in complex with the vinculin binding…
3MYI 2.2 Å, Human metavinculin tail domain
4DJ9 2.25 Å, Human vinculin head domain Vh1 (residues 1-258) in complex with the talin vinculin…
1RKE 2.35 Å, Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
1SYQ 2.42 Å, Human vinculin head domain VH1, residues 1-258, in complex with human talin's vinculin…
5L0I 2.45 Å, Human metavinculin MVt R975W cardiomyopathy-associated mutant (residues 959-1134)
3VF0 2.54 Å, Raver1 in complex with metavinculin L954 deletion mutant

Browse structure collections

About this viewer

MolViewer shows 3H2V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.