3SO8: ANKRA

Crystal Structure of ANKRA. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Oct 2011.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,256
Mol. weight: 17.67 kDa
Released: 5 Oct 2011

Explore 3SO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SO8 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	12-18	7
α-helix	21-30	10
α-helix	44-50	7
α-helix	54-62	9
α-helix	77-83	7
α-helix	87-95	9
α-helix	110-116	7
α-helix	120-128	9
α-helix	143-150	8
α-helix	153-166	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin repeat family A protein 2	A	protein	162	Homo sapiens	Q9H9E1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SO8_1 Ankyrin repeat family A protein 2 (chains A)
NSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADP
QLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLL
ESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN

Primary citation

Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock. Xu, C., Jin, J., Bian, C. et al. Sci Signal (2012) 5:ra39-ra39. DOI 10.1126/scisignal.2002979 · PubMed

Other PDB entries of the same protein (UniProt Q9H9E1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V31 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
4LG6 1.8 Å, Crystal structure of ANKRA2-CCDC8 complex
3V2X 1.85 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3V2O 1.89 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
4QQI 2.03 Å, Crystal structure of ANKRA2-RFX7 complex
8CXG 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXH 3.2 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…
8CXI 3.4 Å, Structures of Zika Virus in Complex with Antibodies Targeting E Dimer Epitopes and Basis…

Browse structure collections

About this viewer

MolViewer shows 3SO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.