The structure of the first YWTD beta propeller domain of LRP6 in complex with a DKK1 peptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Sept 2011.
Explore 3SOQ in 3D Show helices and sheets RCSB PDB PDBe
3SOQ contains 8 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-26 | 5 | 1 |
| β-strand | 28-35 | 8 | 1 |
| α-helix | 36-38 | 3 | |
| α-helix | 42-43 | 2 | |
| β-strand | 44-59 | 16 | 1 |
| α-helix | 60-62 | 3 | |
| β-strand | 64-69 | 6 | 1 |
| β-strand | 74-79 | 6 | 1 |
| α-helix | 85-87 | 3 | |
| β-strand | 88-92 | 5 | 1 |
| β-strand | 99-103 | 5 | 2 |
| β-strand | 108-113 | 6 | 2 |
| β-strand | 118-123 | 6 | 2 |
| β-strand | 130-133 | 4 | 2 |
| β-strand | 140-146 | 7 | 3 |
| β-strand | 151-156 | 6 | 3 |
| β-strand | 162-167 | 6 | 3 |
| β-strand | 174-177 | 4 | 3 |
| β-strand | 184-190 | 7 | 4 |
| β-strand | 195-200 | 6 | 4 |
| β-strand | 205-210 | 6 | 4 |
| β-strand | 217-220 | 4 | 4 |
| β-strand | 227-233 | 7 | 5 |
| β-strand | 236-241 | 6 | 5 |
| β-strand | 246-251 | 6 | 5 |
| β-strand | 259-262 | 4 | 5 |
| β-strand | 271-273 | 3 | 1 |
| α-helix | 276-278 | 3 | |
| α-helix | 290-292 | 3 | |
| β-strand | 296-299 | 4 | 6 |
| β-strand | 306-309 | 4 | 6 |
| α-helix | 314-315 | 2 | |
| β-strand | 316 | 1 | 7 |
| α-helix | 317 | 1 | |
| β-strand | 323 | 1 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Low-density lipoprotein receptor-related protein 6 | A | protein | 318 | Homo sapiens | O75581 (AlphaFold model) |
| Dickkopf-related protein 1 | Z | protein | 9 | Homo sapiens | O94907 (AlphaFold model) |
>3SOQ_1 Low-density lipoprotein receptor-related protein 6 (chains A) AGSAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIK RTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQE LDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKL YWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGE GLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKL LENGKTCKDGNSHHHHHH
>3SOQ_2 Dickkopf-related protein 1 (chains Z) XNSNAIKNX
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| FUC | alpha-L-fucopyranose | C6 H12 O5 | 1 |
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (GOL) are not listed.
Wnt antagonists bind through a short peptide to the first beta-propeller domain of LRP5/6. Bourhis, E., Wang, W., Tam, C. et al. Structure (2011) 19:1433-1442. DOI 10.1016/j.str.2011.07.005 · PubMed
Other PDB entries of the same protein (UniProt O75581 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3SOQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.