Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Mar 2014.
Explore 4NM5 in 3D Show helices and sheets RCSB PDB PDBe
4NM5 contains 24 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 27-30 | 4 | 1 |
| β-strand | 36-44 | 9 | 1 |
| β-strand | 52-64 | 13 | 1 |
| β-strand | 68-75 | 8 | 1 |
| β-strand | 81-88 | 8 | 1 |
| β-strand | 93 | 1 | 2 |
| α-helix | 97-101 | 5 | |
| β-strand | 109 | 1 | 3 |
| β-strand | 112-118 | 7 | 1 |
| β-strand | 127-133 | 7 | 1 |
| β-strand | 137-138 | 2 | 3 |
| α-helix | 139-148 | 10 | |
| α-helix | 152-154 | 3 | |
| α-helix | 155-173 | 19 | |
| β-strand | 177-178 | 2 | 4 |
| α-helix | 184-186 | 3 | |
| β-strand | 187-190 | 4 | 3 |
| β-strand | 195-198 | 4 | 3 |
| β-strand | 205-206 | 2 | 4 |
| α-helix | 225-228 | 4 | |
| α-helix | 237-252 | 16 | |
| α-helix | 262-273 | 12 | |
| α-helix | 276-277 | 2 | |
| α-helix | 278-284 | 7 | |
| α-helix | 286-288 | 3 | |
| α-helix | 296-300 | 5 | |
| α-helix | 301-304 | 4 | |
| α-helix | 311-320 | 10 | |
| α-helix | 325-327 | 3 | |
| α-helix | 329-330 | 2 | |
| α-helix | 331-335 | 5 | |
| α-helix | 338-344 | 7 | |
| β-strand | 349 | 1 | 5 |
| α-helix | 354 | 1 | |
| β-strand | 355 | 1 | 5 |
| α-helix | 356 | 1 | |
| α-helix | 371-373 | 3 | |
| α-helix | 374-377 | 4 | |
| α-helix | 380-382 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 385-399 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1573 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GSK3B protein | A | protein | 377 | Homo sapiens | P49841 (AlphaFold model) |
| Axin-1 | B | protein | 24 | Homo sapiens | O15169 (AlphaFold model) |
| Phosphorylated Wnt receptor LRP6 c-motif | C | protein | 9 | Homo sapiens | O75581 (AlphaFold model) |
>4NM5_1 GSK3B protein (chains A) SCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQ AKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVL DYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPD TAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLL GQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPE AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPP LATILIPPHARHHHHHH
>4NM5_2 Axin-1 (chains B) GGILVEPQKFAEELIHRLEAVQRT
>4NM5_3 Phosphorylated Wnt receptor LRP6 c-motif (chains C) MPPPPTPRS
Water and common crystallization additives (CL, GOL) are not listed.
Structural basis of GSK-3 inhibition by N-terminal phosphorylation and by the Wnt receptor LRP6. Stamos, J.L., Chu, M.L., Enos, M.D. et al. Elife (2014) 3:e01998-e01998. PubMed
Other PDB entries of the same protein (UniProt P49841 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NM5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.