1.15 A structure of human frataxin variant Q153A. Determined by X-ray diffraction at 1.15 Å resolution. Released 10 Aug 2011.
Explore 3T3L in 3D Show helices and sheets RCSB PDB PDBe
3T3L contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 92-114 | 23 | |
| β-strand | 124-128 | 5 | 1 |
| β-strand | 131-135 | 5 | 1 |
| β-strand | 142-148 | 7 | 1 |
| β-strand | 153-157 | 5 | 1 |
| β-strand | 164-168 | 5 | 1 |
| β-strand | 173-175 | 3 | 1 |
| β-strand | 181 | 1 | 1 |
| α-helix | 182-194 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Frataxin, mitochondrial | A | protein | 129 | Homo sapiens | Q16595 (AlphaFold model) |
>3T3L_1 Frataxin, mitochondrial (chains A) GTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLG TYVINKQTPNKAIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLS SLAYSGKDA
Structure-Function Analysis of Friedreich's Ataxia Mutants Reveals Determinants of Frataxin Binding and Activation of the Fe-S Assembly Complex. Bridwell-Rabb, J., Winn, A.M., Barondeau, D.P. Biochemistry (2011) 50:7265-7274. DOI 10.1021/bi200895k · PubMed
Other PDB entries of the same protein (UniProt Q16595 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3T3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.