3T7K: Regulator of Ty1 transposition protein 107

Complex structure of Rtt107p and phosphorylated histone H2A. Determined by X-ray diffraction at 2.03 Å resolution. Released 15 Feb 2012.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 3,972
Mol. weight: 60.63 kDa
Released: 15 Feb 2012

Explore 3T7K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T7K contains 28 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	822-827	6
β-strand	837-841	5	1
α-helix	851-859	9
β-strand	862-864	3	1
α-helix	870-872	3
β-strand	876-878	3	1
β-strand	885	1	2
α-helix	886-891	6
β-strand	899-901	3	1
α-helix	904-913	10
β-strand	931	1	1
α-helix	932	1
α-helix	937-942	6
α-helix	949-952	4
β-strand	957-961	5	3
α-helix	968-977	10
β-strand	982-986	5	3
α-helix	993-995	3
α-helix	996-998	3
β-strand	1012-1015	4	3
α-helix	1019-1032	14
β-strand	1038-1041	4	3
α-helix	1043-1051	9
β-strand	1063-1067	5	3

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	129-130	2
β-strand	131	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of Ty1 transposition protein 107	A, B	protein	256	Saccharomyces cerevisiae	P38850 (AlphaFold model)
Histone H2A.1	C, D	protein	8	Saccharomyces cerevisiae	P04911 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3T7K_1 Regulator of Ty1 transposition protein 107 (chains A, B)
GSPHMTKAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKL
NCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHSKKDKLSQININLFDYEING
INESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFE
DIIPNDVSKQENGGIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLN
VDFTSKKNVLYQKKNN

Sequence of entity 2 (C, D), FASTA

>3T7K_2 Histone H2A.1 (chains C, D)
ATKASQEL

Primary citation

Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair. Li, X., Liu, K., Li, F. et al. J Biol Chem (2012) 287:9137-9146. DOI 10.1074/jbc.M111.311860 · PubMed

Other PDB entries of the same protein (UniProt P38850 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J0Y 1.8 Å, Crystal Structure of Yeast Rtt107 and Slx4
3T7J 2.04 Å, Crystal structure of Rtt107p (residues 820-1070)
3T7I 2.3 Å, Crystal structure of Se-Met Rtt107p (residues 820-1070)
6J0X 2.31 Å, Crystal Structure of Yeast Rtt107 and Mms22
6J0V 2.31 Å, Crystal Structure of Yeast Rtt107
6J0W 2.4 Å, Crystal Structure of Yeast Rtt107 and Nse6

Browse structure collections

About this viewer

MolViewer shows 3T7K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.