3TO6: Yeast Esa1 HAT domain

Crystal structure of yeast Esa1 HAT domain complexed with H4K16CoA bisubstrate inhibitor. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 Nov 2011.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,652
Mol. weight: 35.31 kDa
Ligands: CMC
Released: 9 Nov 2011

Explore 3TO6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TO6 contains 11 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	169-172	4	1
β-strand	175-177	3	1
β-strand	194-197	4	1
β-strand	204-205	2	1
α-helix	208-215	8
β-strand	226-230	5	2
β-strand	234-240	7	2
α-helix	241-243	3
α-helix	245-256	12
β-strand	271-280	10	2
β-strand	283-293	11	2
β-strand	300-302	3	3
β-strand	305-307	3	2
α-helix	309-311	3
α-helix	316-330	15
β-strand	335	1	4
β-strand	336-337	2	3
α-helix	341-342	2
α-helix	343-363	21
β-strand	367-369	3	5
α-helix	370-377	8
β-strand	379	1	4
α-helix	381-390	10
β-strand	394-397	4	5
β-strand	400-404	5	5
α-helix	407-418	12
α-helix	426-428	3
β-strand	429	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase ESA1	A	protein	276	Saccharomyces cerevisiae	Q08649 (AlphaFold model)
Histone H4	B	protein	12	Saccharomyces cerevisiae	P02309 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TO6_1 Histone acetyltransferase ESA1 (chains A)
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCT
LRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRR
DELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEK
PLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKG
QHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV

Sequence of entity 2 (B), FASTA

>3TO6_2 Histone H4 (chains B)
GKGGAKRHRKIL

Ligands and cofactors

ID	Name	Formula	Copies
CMC	Carboxymethyl coenzyme *a	C23 H38 N7 O18 P3 S	1

Primary citation

MYST protein acetyltransferase activity requires active site lysine autoacetylation. Yuan, H., Rossetto, D., Mellert, H. et al. EMBO J (2011) 31:58-70. DOI 10.1038/emboj.2011.382 · PubMed

Other PDB entries of the same protein (UniProt Q08649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TO7 1.9 Å, Crystal structure of yeast Esa1 HAT domain bound to coenzyme A with active site lysine…
1FY7 2.0 Å, Crystal structure of yeast ESA1 histone acetyltransferase domain complexed with coenzyme a
3TO9 2.0 Å, Crystal structure of yeast Esa1 E338Q HAT domain bound to coenzyme A with active site…
1MJA 2.26 Å, Crystal structure of yeast Esa1 histone acetyltransferase domain complexed with acetyl…
1MJ9 2.5 Å, Crystal structure of yeast Esa1(C304S) mutant complexed with Coenzyme A
1MJB 2.5 Å, Crystal structure of yeast Esa1 histone acetyltransferase E338Q mutant complexed with…
5J9T 2.7 Å, Crystal structure of the NuA4 core complex
5J9W 2.8 Å, Crystal structure of the NuA4 core complex
5J9U 2.95 Å, Crystal structure of the NuA4 core complex
5J9Q 3.25 Å, Crystal structure of the NuA4 core complex
7VVU 3.4 Å, NuA4 HAT module bound to the nucleosome
8X2X 3.8 Å, The piccolo NuA4 bound to the H2A.Z nucleosome complex at pre-H4-acetylation state

Browse structure collections

About this viewer

MolViewer shows 3TO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.