Crystal structure of yeast Esa1 E338Q HAT domain bound to coenzyme A with active site lysine acetylated. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Nov 2011.
Explore 3TO9 in 3D Show helices and sheets RCSB PDB PDBe
3TO9 contains 9 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 169-172 | 4 | 1 |
| β-strand | 175-177 | 3 | 1 |
| β-strand | 194-197 | 4 | 1 |
| β-strand | 204-205 | 2 | 1 |
| α-helix | 208-215 | 8 | |
| β-strand | 226-230 | 5 | 2 |
| β-strand | 234-240 | 7 | 2 |
| α-helix | 245-256 | 12 | |
| β-strand | 271-280 | 10 | 2 |
| β-strand | 283-293 | 11 | 2 |
| β-strand | 300-302 | 3 | 3 |
| β-strand | 305-307 | 3 | 2 |
| α-helix | 309-311 | 3 | |
| α-helix | 316-330 | 15 | |
| β-strand | 335 | 1 | 4 |
| β-strand | 336-337 | 2 | 3 |
| α-helix | 343-363 | 21 | |
| β-strand | 367-369 | 3 | 5 |
| α-helix | 370-377 | 8 | |
| β-strand | 379 | 1 | 4 |
| α-helix | 381-390 | 10 | |
| β-strand | 394-397 | 4 | 5 |
| β-strand | 400-404 | 5 | 5 |
| α-helix | 407-418 | 12 | |
| α-helix | 426-428 | 3 | |
| β-strand | 429 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone acetyltransferase ESA1 | A | protein | 276 | Saccharomyces cerevisiae | Q08649 (AlphaFold model) |
>3TO9_1 Histone acetyltransferase ESA1 (chains A) EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCT LRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRR DELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQK PLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKG QHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Water and common crystallization additives (SO4, EDO) are not listed.
MYST protein acetyltransferase activity requires active site lysine autoacetylation. Yuan, H., Rossetto, D., Mellert, H. et al. EMBO J (2011) 31:58-70. DOI 10.1038/emboj.2011.382 · PubMed
Other PDB entries of the same protein (UniProt Q08649 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.