3TOJ: SPRY domain of human Ash2L

Structure of the SPRY domain of human Ash2L. Determined by X-ray diffraction at 2.07 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 2.07 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,403
Mol. weight: 47.87 kDa
Released: 25 Jan 2012

Explore 3TOJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TOJ contains 7 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	277-279	3
β-strand	282-284	3	1
β-strand	289-294	6	2
β-strand	299-300	2	3
β-strand	306-308	3	3
β-strand	314-318	5	2
β-strand	322	1	4
β-strand	325-335	11	3
β-strand	341-347	7	2
β-strand	363-367	5	2
β-strand	373-375	3	2
β-strand	378-380	3	2
β-strand	391-398	8	3
β-strand	446-451	6	3
β-strand	454-461	8	3
α-helix	463-464	2
β-strand	468	1	4
β-strand	469-475	7	2
β-strand	479-483	5	3
β-strand	498-499	2	3
α-helix	500-504	5
β-strand	505-508	4	1
α-helix	509-510	2

Chain B: 3 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	277-279	3
β-strand	282-284	3	1
β-strand	289-294	6	5
β-strand	299-300	2	6
β-strand	306-308	3	6
β-strand	314-318	5	5
β-strand	322	1	7
β-strand	325-335	11	6
β-strand	341-347	7	5
β-strand	363-367	5	5
β-strand	373-375	3	5
β-strand	378-380	3	5
β-strand	391-398	8	6
β-strand	446-451	6	6
β-strand	454-461	8	6
α-helix	463-464	2
β-strand	468	1	7
β-strand	469-475	7	5
β-strand	479-483	5	6
β-strand	498-499	2	6
α-helix	500-504	5
β-strand	505-508	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Set1/Ash2 histone methyltransferase complex subunit ASH2	A, B	protein	213	Homo sapiens	Q9UBL3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3TOJ_1 Set1/Ash2 histone methyltransferase complex subunit ASH2 (chains A, B)
SGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVD
EMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGF
YINLPEDTISGRGSSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKY
PPKDLTYRPMSDMGWGAVVEHTLADVLYHVETE

Primary citation

Structure of the SPRY domain of human Ash2L and its interactions with RbBP5 and DPY30. Chen, Y., Cao, F., Wan, B. et al. Cell Res (2012) 22:598-602. DOI 10.1038/cr.2012.9 · PubMed

Other PDB entries of the same protein (UniProt Q9UBL3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5F6L 1.9 Å, The crystal structure of MLL1 (N3861I/Q3867L) in complex with RbBP5 and Ash2L
3RSN 2.1 Å, Crystal Structure of the N-terminal region of Human Ash2L
4X8N 2.1 Å, Crystal structure of Ash2L SPRY domain in complex with phosphorylated RbBP5
7W67 2.19 Å, The crystal structure of MLL1 (N3861I/Q3867L/C3882SS)-RBBP5-ASH2L in complex with…
4X8P 2.2 Å, Crystal structure of Ash2L SPRY domain in complex with RbBP5
7W6A 2.21 Å, Crystal structure of the MLL1 (N3861I/Q3867L/C3882SS)-RBBP5-ASH2L complex
4RIQ 2.23 Å, Crystal structure of DPY-30 dimerization/docking domain in complex with Ash2L…
6E2H 2.24 Å, Crystal structure of human Ash2L (SPRY domain and SDI motif) in complex with full length…
7W6L 2.26 Å, The crystal structure of MLL3-RBBP5-ASH2L in complex with H3K4me0 peptide
5F6K 2.41 Å, Crystal structure of the MLL3-Ash2L-RbBP5 complex
3S32 2.45 Å, Crystal structure of Ash2L N-terminal domain
7W6I 2.56 Å, The crystal structure of MLL1 (N3861I/Q3867L/C3882SS)-RBBP5-ASH2L in complex with…

Browse structure collections

About this viewer

MolViewer shows 3TOJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.