Crystal Structure of the Burkholderia Lethal Factor 1 (BLF1). Determined by X-ray diffraction at 1.04 Å resolution. Released 30 Nov 2011.
Explore 3TU8 in 3D Show helices and sheets RCSB PDB PDBe
3TU8 contains 9 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-15 | 11 | |
| β-strand | 20-23 | 4 | 1 |
| α-helix | 25-29 | 5 | |
| α-helix | 31 | 1 | |
| β-strand | 33-42 | 10 | 1 |
| β-strand | 45-49 | 5 | 1 |
| β-strand | 57-64 | 8 | 1 |
| β-strand | 71-74 | 4 | 2 |
| α-helix | 76-78 | 3 | |
| β-strand | 85-88 | 4 | 1 |
| β-strand | 91 | 1 | 1 |
| β-strand | 95-99 | 5 | 2 |
| β-strand | 104-107 | 4 | 2 |
| α-helix | 113-121 | 9 | |
| α-helix | 124-127 | 4 | |
| β-strand | 134-142 | 9 | 2 |
| α-helix | 147-149 | 3 | |
| β-strand | 156-158 | 3 | 2 |
| α-helix | 160-161 | 2 | |
| β-strand | 162-164 | 3 | 2 |
| β-strand | 166 | 1 | 3 |
| β-strand | 169 | 1 | 3 |
| β-strand | 171-180 | 10 | 1 |
| β-strand | 183-192 | 10 | 1 |
| β-strand | 195-196 | 2 | 1 |
| α-helix | 197-199 | 3 | |
| β-strand | 200-202 | 3 | 1 |
| β-strand | 205-209 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Burkholderia Lethal Factor 1 (BLF1) | A | protein | 210 | Burkholderia pseudomallei | Q63UP7 (AlphaFold model) |
>3TU8_1 Burkholderia Lethal Factor 1 (BLF1) (chains A) PNSLEAQIRQAMKTGSTLTIEFDQALNQKSPGTLNVFLHPANGGVRIDLDSGNQGEPAKI LWLPWKQGELQTLQPGSISTVDMLFFTYYLSGCKVFAGDGGPVWHIDAPVEANQFWRRMS SDEWMEDWEVGTDRQVAYLHRAGQSDSLWNLSAYLEGAAPSTYGRDNLGQAVVGGIVTGR QQMSLYQYATTSSGSSAWSPLTYTLQQRKQ
A Burkholderia pseudomallei toxin inhibits helicase activity of translation factor eIF4A. Cruz-Migoni, A., Hautbergue, G.M., Artymiuk, P.J. et al. Science (2011) 334:821-824. DOI 10.1126/science.1211915 · PubMed
Other PDB entries of the same protein (UniProt Q63UP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TU8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.