3TUG: HECT domain of ITCH E3 ubiquitin ligase

Name: PDB 3TUG: Crystal structure of the HECT domain of ITCH E3 ubiquitin ligase
Published: 2011-10-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of the HECT domain of ITCH E3 ubiquitin ligase. Determined by X-ray diffraction at 2.27 Å resolution. Released 12 Oct 2011.

Method: X-ray diffraction
Resolution: 2.27 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,771
Mol. weight: 47.53 kDa
Released: 12 Oct 2011

Explore 3TUG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TUG contains 21 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	528-539	12
β-strand	547-551	5	1
α-helix	557-567	11
α-helix	572-574	3
β-strand	576-580	5	1
α-helix	589-603	15
β-strand	612-614	3	2
β-strand	621-624	4	2
α-helix	626-630	5
α-helix	634-650	17
β-strand	658-659	2	2
α-helix	661-667	7
α-helix	675-677	3
α-helix	682-692	11
α-helix	735-747	13
α-helix	751-764	14
α-helix	767-770	4
α-helix	775-783	9
α-helix	786-788	3
α-helix	790-795	6
β-strand	798-800	3	3
α-helix	807-818	12
α-helix	821-832	12
α-helix	842-844	3
β-strand	846	1	4
β-strand	851	1	4
β-strand	855-858	4	3
α-helix	865-866	2
β-strand	867-869	3	3
α-helix	870-872	3
β-strand	874-877	4	3
α-helix	883-895	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase Itchy homolog	A	protein	398	Homo sapiens	Q96J02 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TUG_1 E3 ubiquitin-protein ligase Itchy homolog (chains A)
MHHHHHHSSGRENLYFQGYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQI
MSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVSNPMYCLFEYAGKDNYCLQIN
PASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFY
NSLIWVKENNIEECDLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWR
LSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRRYART
SKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWL
PRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE

Primary citation

Crystal structure of the HECT domain of ITCH E3 ubiquitin ligase. Dobrovetsky, E., Dong, A., Xue, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q96J02 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CQ2 1.4 Å, Crystal Structure of tandem WW domains of ITCH in complex with TXNIP peptide
5DZD 1.57 Å, Crystal Structure of WW4 domain of ITCH in complex with TXNIP peptide
5DWS 1.65 Å, Crystal Structure of ITCH WW3 domain in complex with TXNIP peptide
5SXP 1.65 Å, Structural basis for the interaction between itch prr and beta-pix
2NQ3 1.8 Å, Crystal structure of the C2 Domain of Human Itchy Homolog E3 Ubiquitin Protein Ligase
2P4R 2.0 Å, Structural basis for a novel interaction between AIP4 and beta-PIX
4ROF 2.03 Å, Crystal Structure of WW3 domain of ITCH in complex with TXNIP peptide
5C7M 3.03 Å, Crystal structure of E3 ligase itch with a ub variant
2DMV Solution structure of the second ww domain of Itchy homolog E3 ubiquitin protein ligase…
2KYK The sandwich region between two LMP2A PY motif regulates the interaction between…
2YSF Solution structure of the fourth WW domain from the human E3 ubiquitin-protein ligase…

Browse structure collections

About this viewer

MolViewer shows 3TUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.