3TV3: PGT128 light chain, Ig lambda-2 chain C regions

Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with Man9. Determined by X-ray diffraction at 1.29 Å resolution. Released 19 Oct 2011.

Method: X-ray diffraction
Resolution: 1.29 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,750
Mol. weight: 49.8 kDa
Ligands: AML
Released: 19 Oct 2011

Explore 3TV3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TV3 contains 17 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
β-strand	35-39	7	9
β-strand	46-52	7	9
β-strand	56-59	4	9
α-helix	64-66	3
β-strand	67-72	6	7
α-helix	73-75	3
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-98	11	9
β-strand	100G-103	8	9
β-strand	107-109	3	9
β-strand	110-111	2	8
α-helix	114-116	3
β-strand	117	1	10
α-helix	118-119	2
β-strand	120-124	5	11
α-helix	125-127	3
β-strand	137-147	11	11
β-strand	148	1	10
β-strand	153-157	4	12
α-helix	158-164	3
β-strand	166	1	12
β-strand	170-173	3	11
α-helix	174-176	3
β-strand	177-178	2	11
β-strand	185-194	10	11
α-helix	195-197	3
β-strand	207-212	6	12
α-helix	213-215	3
β-strand	217-222	6	12

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-13	4	2
β-strand	19-24	6	1
β-strand	33-38	6	2
β-strand	45-48	4	2
β-strand	49	1	3
β-strand	53	1	3
α-helix	54-55	2
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-92	9	2
β-strand	95A-98	4	2
β-strand	102-106	5	2
β-strand	111	1	4
α-helix	112-113	2
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-139	10	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-161	3	5
α-helix	162-164	3
β-strand	165-166	2	5
β-strand	173-181	9	5
α-helix	183-188	6
β-strand	192-198	7	6
β-strand	203-209	7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PGT128 light chain, Ig lambda-2 chain C regions	L	protein	211	Homo sapiens	P0DOY2 (AlphaFold model)
PGT128 heavy chain, Ig gamma-1 chain C region	H	protein	239	Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>3TV3_1 PGT128 light chain, Ig lambda-2 chain C regions (chains L)
QSALTQPPSASGSPGQSITISCTGTSNNFVSWYQQHAGKAPKLVIYDVNKRPSGVPDRFS
GSKSGNTASLTVSGLQTDDEAVYYCGSLVGNWDVIFGGGTKLTVLGQPKAAPSVTLFPPS
SEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLT
PEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 2 (H), FASTA

>3TV3_2 PGT128 heavy chain, Ig gamma-1 chain C region (chains H)
QPQLQESGPTLVEASETLSLTCAVSGDSTAACNSFWGWVRQPPGKGLEWVGSLSHCASYW
NRGWTYHNPSLKSRLTLALDTPKNLVFLKLNSVTAADTATYYCARFGGEVLRYTDWPKPA
WVDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD

Ligands and cofactors

ID	Name	Formula	Copies
AML	Amylamine	C5 H13 N	1

Water and common crystallization additives (EPE, GOL) are not listed.

Primary citation

A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield. Pejchal, R., Doores, K.J., Walker, L.M. et al. Science (2011) 334:1097-1103. DOI 10.1126/science.1213256 · PubMed

Other PDB entries of the same protein (UniProt P0DOY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
4LLY 1.6 Å, Crystal structure of Pertuzumab Clambda Fab with variable and constant domain redesigns…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
4LLM 1.75 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
8ECV 1.81 Å, Bovine Fab 2F12
1AQK 1.84 Å, Three-dimensional structure of a human FAB with high affinity for tetanus toxoid
1JVK 1.94 Å, Three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal…
4LLW 1.95 Å, Crystal structure of Pertuzumab Clambda Fab with variable domain redesign (VRD2) at 1.95A
4EOW 1.97 Å, Crystal structure of a disease-associated anti-human GM-CSF autoantibody MB007
7FAB 2.0 Å, Crystal structure of human immunoglobulin fragment FAB new refined at 2.0 Å resolution
8ECQ 2.0 Å, Bovine Fab 2G3

Browse structure collections

About this viewer

MolViewer shows 3TV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.