3U21: PDB entry 3U21

Crystal structure of a Fragment of Nuclear factor related to kappa-B-binding protein (residues 370-495) (NFRKB) from Homo sapiens at 2.18 A resolution. Determined by X-ray diffraction at 2.18 Å resolution. Released 2 Nov 2011.

Method: X-ray diffraction
Resolution: 2.18 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,763
Mol. weight: 29.03 kDa
Released: 2 Nov 2011

Explore 3U21 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U21 contains 14 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	379-388	10
β-strand	392-394	3	1
α-helix	395-406	12
α-helix	409-413	5
α-helix	417-419	3
α-helix	424-426	3
α-helix	427-434	8
β-strand	449-452	4	1
β-strand	457-460	4	1
α-helix	468-481	14

Chain B: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	379-390	12
β-strand	392-393	2	2
α-helix	395-407	13
α-helix	409-413	5
α-helix	417-419	3
α-helix	423-426	4
α-helix	427-434	8
β-strand	449-452	4	2
β-strand	457-460	4	2
α-helix	468-481	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor related to kappa-B-binding protein	A, B	protein	127	Homo sapiens	Q6P4R8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3U21_1 Nuclear factor related to kappa-B-binding protein (chains A, B)
GLGINEISSSFFSLLLEILLLESQASLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVL
PALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCK
QENEDSS

Primary citation

Structure of a Novel Winged-Helix Like Domain from Human NFRKB Protein. Kumar, A., Mocklinghoff, S., Yumoto, F. et al. PLoS One (2012) 7:e43761-e43761. DOI 10.1371/journal.pone.0043761 · PubMed

Other PDB entries of the same protein (UniProt Q6P4R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WLP 3.1 Å, Crystal structure of UCH37-NFRKB Inhibited Deubiquitylating Complex
4UF6 3.69 Å, UCH-L5 in complex with ubiquitin-propargyl bound to an activating fragment of INO80G
4UF5 3.7 Å, Crystal structure of UCH-L5 in complex with inhibitory fragment of INO80G

Browse structure collections

About this viewer

MolViewer shows 3U21 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.