Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese. Determined by X-ray diffraction at 2.05 Å resolution. Released 2 Nov 2011.
Explore 3U2T in 3D Show helices and sheets RCSB PDB PDBe
3U2T contains 19 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-10 | 10 | 1 |
| α-helix | 13-28 | 16 | |
| β-strand | 33-39 | 7 | 1 |
| α-helix | 45-52 | 8 | |
| β-strand | 57-60 | 4 | 1 |
| α-helix | 71-76 | 6 | |
| α-helix | 78-80 | 3 | |
| α-helix | 81-87 | 7 | |
| α-helix | 88-91 | 4 | |
| β-strand | 97-101 | 5 | 1 |
| β-strand | 105-107 | 3 | 2 |
| α-helix | 112-116 | 5 | |
| β-strand | 121-124 | 4 | 1 |
| α-helix | 125 | 1 | |
| β-strand | 132-139 | 8 | 1 |
| α-helix | 143-156 | 14 | |
| α-helix | 163-170 | 8 | |
| α-helix | 179-181 | 3 | |
| β-strand | 182 | 1 | 1 |
| α-helix | 185-187 | 3 | |
| β-strand | 189-190 | 2 | 2 |
| α-helix | 198-204 | 7 | |
| α-helix | 205-207 | 3 | |
| β-strand | 210-212 | 3 | 2 |
| α-helix | 219-221 | 3 | |
| α-helix | 223 | 1 | |
| β-strand | 224-225 | 2 | 3 |
| β-strand | 230-231 | 2 | 3 |
| α-helix | 244-252 | 9 | |
| α-helix | 253-257 | 5 | |
| α-helix | 258-260 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycogenin-1 | A | protein | 284 | Homo sapiens | P46976 (AlphaFold model) |
>3U2T_1 Glycogenin-1 (chains A) MHHHHHHSSGVDLGTENLYFQSMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVL ATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKC VFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGS FDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVK PWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 1 |
Water and common crystallization additives (EDO) are not listed.
Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis. Chaikuad, A., Froese, D.S., Berridge, G. et al. Proc Natl Acad Sci U S A (2011) 108:21028-21033. DOI 10.1073/pnas.1113921108 · PubMed
Other PDB entries of the same protein (UniProt P46976 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3U2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.