3U43: Colicin E2 DNase-Im2 complex

Crystal structure of the colicin E2 DNase-Im2 complex. Determined by X-ray diffraction at 1.72 Å resolution. Released 21 Mar 2012.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,206
Mol. weight: 26.56 kDa
Ligands: ZN, CA
Released: 21 Mar 2012

Explore 3U43 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U43 contains 19 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	11	1	1
α-helix	12-24	13
α-helix	30-44	15
α-helix	51-54	4
α-helix	64-77	14
α-helix	83	1
β-strand	84	1	1
α-helix	85	1

Chain B: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	9-10	2	2
β-strand	12	1	3
β-strand	16	1	4
α-helix	22-27	6
β-strand	32-33	2	5
α-helix	34	1
β-strand	35	1	4
α-helix	36-42	7
β-strand	46-47	2	2
α-helix	50-62	13
α-helix	65-68	4
α-helix	73-80	8
α-helix	83-85	3
β-strand	86	1	6
α-helix	87-88	2
α-helix	89-91	3
β-strand	93	1	7
β-strand	96	1	7
β-strand	98	1	6
β-strand	100-103	4	5
α-helix	107-109	3
β-strand	115	1	3
β-strand	119-122	4	5
α-helix	124-131	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin-E2 immunity protein	A	protein	94	Escherichia coli	P04482 (AlphaFold model)
Colicin-E2	B	protein	134	Escherichia coli	P04419 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3U43_1 Colicin-E2 immunity protein (chains A)
MELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDR
EDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH

Sequence of entity 2 (B), FASTA

>3U43_2 Colicin-E2 (chains B)
MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEE
VSKDPDLSKQFKGSNKTNIQKGKAPFARKKDQVGGRERFELHHDKPISQDGGVYDMNNIR
VTTPKRHIDIHRGK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
CA	Calcium ion	Ca	1

Primary citation

Structure of the Ultra-High-Affinity Colicin E2 DNase-Im2 Complex. Wojdyla, J.A., Fleishman, S.J., Baker, D. et al. J Mol Biol (2012) 417:79-94. DOI 10.1016/j.jmb.2012.01.019 · PubMed

Other PDB entries of the same protein (UniProt P04482 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WPT 1.78 Å, The crystal structure of Im2 in complex with colicin E9 DNase
2NO8 NMR Structure analysis of the colicin immuntiy protein IM2

Browse structure collections

About this viewer

MolViewer shows 3U43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.