3U73: Stabilized human uPAR mutant

Crystal structure of stabilized human uPAR mutant in complex with ATF. Determined by X-ray diffraction at 3.19 Å resolution. Released 18 Apr 2012.

Method: X-ray diffraction
Resolution: 3.19 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,133
Mol. weight: 47.89 kDa
Released: 18 Apr 2012

Explore 3U73 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3U73 contains 9 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	4
β-strand	28-31	4	4
β-strand	37	1	7
β-strand	45	1	7
β-strand	65	1	8
α-helix	69-70	2
β-strand	71	1	9
α-helix	72-73	2
α-helix	78-80	3
α-helix	91-94	4
β-strand	103	1	9
β-strand	112-117	6	9
β-strand	120-125	6	9
β-strand	126	1	8

Chain U: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	14-16	3	1
β-strand	23-32	10	2
β-strand	37-46	10	2
β-strand	53-59	7	2
β-strand	62-71	10	2
α-helix	76-78	3
β-strand	93-97	5	3
β-strand	98-99	2	2
β-strand	111-115	5	3
β-strand	121-129	9	2
β-strand	140	1	4
β-strand	144-149	6	2
β-strand	155-161	7	2
β-strand	164-171	8	2
α-helix	184-186	3
β-strand	189-196	8	5
β-strand	197-199	3	2
β-strand	200	1	6
β-strand	203-204	2	6
β-strand	211-216	6	5
β-strand	221-228	8	2
β-strand	237-242	6	2
α-helix	245-247	3
α-helix	252-256	5
β-strand	259-266	8	2
α-helix	274-276	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Urokinase plasminogen activator surface receptor	U	protein	283	Homo sapiens	Q03405 (AlphaFold model)
Urokinase-type plasminogen activator	A	protein	132	Homo sapiens	P00749 (AlphaFold model)

Sequence of entity 1 (U), FASTA

>3U73_1 Urokinase plasminogen activator surface receptor (chains U)
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTCSEKTNRTLSYRTG
LKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEE
QCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGP
ILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRG
CATASMCQHAHLGDAFSMCHIDVSCCTKSGCNHPDLDVQYRSG

Sequence of entity 2 (A), FASTA

>3U73_2 Urokinase-type plasminogen activator (chains A)
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRG
KASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK
PLVQECMVHDCA

Primary citation

Crystal structure of the urokinase receptor in a ligand-free form. Xu, X., Gardsvoll, H., Yuan, C. et al. J Mol Biol (2012) 416:629-641. DOI 10.1016/j.jmb.2011.12.058 · PubMed

Other PDB entries of the same protein (UniProt Q03405 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FD6 1.9 Å, Structure of Human Urokinase Plasminogen Activator in Complex with Urokinase Receptor…
3U74 2.39 Å, Crystal structure of stabilized human uPAR mutant
3BT2 2.5 Å, Structure of urokinase receptor, urokinase and vitronectin complex
1YWH 2.7 Å, crystal structure of urokinase plasminogen activator receptor
2I9B 2.8 Å, Crystal structure of ATF-urokinase receptor complex
3BT1 2.8 Å, Structure of urokinase receptor, urokinase and vitronectin complex
7V63 2.91 Å, Structure of dimeric uPAR at low pH
9YC5 2.94 Å, Human uPAR bound to the Fab fragment of targeted cancer therapeutic antibody FL1
7E17 2.96 Å, Structure of dimeric uPAR
4QTI 3.0 Å, Crystal structure of human uPAR in complex with anti-uPAR Fab 8B12
4K24 4.5 Å, Structure of anti-uPAR Fab ATN-658 in complex with uPAR
9YC6 4.8 Å, Mutant human uPAR bound to the Fab fragment of the targeted cancer therapeutic antibody…

Browse structure collections

About this viewer

MolViewer shows 3U73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.