Structure of dimeric uPAR at low pH. Determined by X-ray diffraction at 2.91 Å resolution. Released 22 Dec 2021.
Explore 7V63 in 3D Show helices and sheets RCSB PDB PDBe
7V63 contains 9 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| β-strand | 6 | 1 | 2 |
| β-strand | 13-16 | 4 | 1 |
| α-helix | 17-18 | 2 | |
| β-strand | 23-33 | 11 | 2 |
| β-strand | 36-46 | 11 | 2 |
| β-strand | 61-69 | 9 | 3 |
| β-strand | 155-159 | 5 | 3 |
| β-strand | 164-172 | 9 | 3 |
| β-strand | 175 | 1 | 3 |
| α-helix | 184-186 | 3 | |
| α-helix | 188 | 1 | |
| β-strand | 189-196 | 8 | 4 |
| β-strand | 197-199 | 3 | 3 |
| β-strand | 200 | 1 | 5 |
| β-strand | 204 | 1 | 5 |
| β-strand | 211-216 | 6 | 4 |
| β-strand | 221-226 | 6 | 3 |
| β-strand | 237-242 | 6 | 3 |
| α-helix | 244-247 | 4 | |
| β-strand | 262-266 | 5 | 3 |
| α-helix | 274-276 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 6 |
| β-strand | 6 | 1 | 2 |
| β-strand | 13-16 | 4 | 6 |
| β-strand | 23-33 | 11 | 2 |
| β-strand | 36-46 | 11 | 2 |
| β-strand | 61-69 | 9 | 7 |
| β-strand | 157-159 | 3 | 7 |
| β-strand | 164-172 | 9 | 7 |
| β-strand | 175 | 1 | 7 |
| α-helix | 184-186 | 3 | |
| α-helix | 188 | 1 | |
| β-strand | 189-196 | 8 | 8 |
| β-strand | 197-198 | 2 | 7 |
| β-strand | 211-216 | 6 | 8 |
| β-strand | 221-226 | 6 | 7 |
| β-strand | 237-242 | 6 | 7 |
| α-helix | 244-247 | 4 | |
| β-strand | 262-266 | 5 | 7 |
| α-helix | 274-276 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Urokinase plasminogen activator surface receptor | A, B | protein | 279 | Homo sapiens | Q03405 (AlphaFold model) |
>7V63_1 Urokinase plasminogen activator surface receptor (chains A, B) RSLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYR TGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNE GPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMV RGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLD
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Crystal structure and cellular functions of uPAR dimer. Yu, S., Sui, Y., Wang, J. et al. Nat Commun (2022) 13:1665. DOI 10.1038/s41467-022-29344-y
Other PDB entries of the same protein (UniProt Q03405 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7V63 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.