3UE7: Novel topological analogue of crambin

X-ray crystal structure of a novel topological analogue of crambin. Determined by X-ray diffraction at 1.08 Å resolution. Released 8 Feb 2012.

Method: X-ray diffraction
Resolution: 1.08 Å
Organism: Crambe hispanica subsp. abyssinica
Chains: 2
Atoms: 746
Mol. weight: 9.39 kDa
Released: 8 Feb 2012

Explore 3UE7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UE7 contains 5 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
α-helix	7-18	12
α-helix	23-30	8
β-strand	33-34	2	1
α-helix	42-44	3

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	2
β-strand	4	1	3
α-helix	7-17	11
α-helix	23-30	8
β-strand	33-34	2	2
β-strand	45	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
D-Crambin	A	protein	46
Crambin	B	protein	46	Crambe hispanica subsp. abyssinica	P01542 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UE7_1 D-Crambin (chains A)
TTCCPSIVARSNFNACRLPGTPEALCATYTGCIIIPGATCPGDYAN

Sequence of entity 2 (B), FASTA

>3UE7_2 Crambin (chains B)
TTCCPSIVAKSNFNACRLPGTPEALCATYTGCIIIPGATCPGDYAN

Primary citation

Design, total chemical synthesis, and x-ray structure of a protein having a novel linear-loop polypeptide chain topology. Mandal, K., Pentelute, B.L., Bang, D. et al. Angew Chem Int Ed Engl (2012) 51:1481-1486. DOI 10.1002/anie.201107846 · PubMed

Other PDB entries of the same protein (UniProt P01542 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NIR 0.48 Å, Crystal structure of small protein crambin at 0.48 A resolution
1EJG 0.54 Å, Crambin at ultra-high resolution: valence electron density.
9EWK 0.7 Å, Solvent organization in ultrahigh-resolution protein crystal structure at room temperature
1CBN 0.83 Å, Atomic resolution (0.83 Å) crystal structure of the hydrophobic protein crambin at 130 K
3U7T 0.85 Å, Room temperature ultra-high resolution time-of-flight neutron and X-ray diffraction…
9PIS 0.85 Å, Ab initio structure of crambin by MicroED at 0.85A
1AB1 0.89 Å, Si form crambin
1JXT 0.89 Å, Crambin mixed sequence form at 160 K. Protein/water substates
1JXW 0.89 Å, Crambin mixed sequence form at 180 K. Protein/water substates
1JXX 0.89 Å, Crambin mixed sequence form at 200 K. Protein/water substates
1JXY 0.89 Å, Crambin mixed sequence form at 220 K. Protein/water substates
1JXU 0.99 Å, Crambin mixed sequence form at 240 K. Protein/water substates

Browse structure collections

About this viewer

MolViewer shows 3UE7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.