3UEH: Human Survivin H80A mutant

Crystal structure of human Survivin H80A mutant. Determined by X-ray diffraction at 2.6 Å resolution. Released 7 Mar 2012.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,201
Mol. weight: 34.07 kDa
Ligands: ZN
Released: 7 Mar 2012

Explore 3UEH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UEH contains 14 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-13	6
α-helix	15-19	5
α-helix	35-40	6
β-strand	43-45	3	1
β-strand	55-57	3	1
β-strand	63-64	2	1
α-helix	73-80	8
α-helix	85-88	4
α-helix	93-95	3
β-strand	97	1	2
α-helix	98-140	43

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 5	A, B	protein	146	Homo sapiens	O15392 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3UEH_1 Baculoviral IAP repeat-containing protein 5 (chains A, B)
GSHEMGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQ
CFFCFKELEGWEPDDDPIEEHKKASSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKE
TNNKKKEFEETAKKVRRAIEQLAAMD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (PGE, PEG, EDO) are not listed.

Primary citation

Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres. Niedzialkowska, E., Wang, F., Porebski, P.J. et al. Mol Biol Cell (2012) 23:1457-1466. DOI 10.1091/mbc.E11-11-0904 · PubMed

Other PDB entries of the same protein (UniProt O15392 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QFA 1.4 Å, Crystal structure of a Survivin-Borealin-INCENP core complex
9TPI 1.8 Å, Survivin 1-122 in complex with a molecular tweezer-Histone-H3-peptide conjugate
6YIF 1.81 Å, Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3…
9TPH 2.0 Å, Survivin 1-127 in complex with a molecular tweezer-Histone-H3-peptide conjugate
3UEC 2.18 Å, Crystal structure of human Survivin bound to histone H3 phosphorylated on threonine-3.
2RAW 2.4 Å, Crystal structure of the Borealin-Survivin complex
3UIG 2.4 Å, crystal structure of human Survivin in complex with T3 phosphorylated H3(1-15) peptide
3UIH 2.4 Å, crystal structure of human Survivin in complex with Smac/DIABLO(1-15) peptide
8RUP 2.42 Å, Chromosome Passenger Complex (CPC) localization module in complex with H3.T3p-nucleosome
3UEF 2.45 Å, Crystal structure of human Survivin bound to histone H3 (C2 space group).
7LBO 2.5 Å, Crystal structure of human Survivin bound to histone H3 T3phK4me1 peptide
6YIH 2.55 Å, Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3…

Browse structure collections

About this viewer

MolViewer shows 3UEH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.