3UK6: Tip48 (Tip49b) hexamer

Crystal Structure of the Tip48 (Tip49b) hexamer. Determined by X-ray diffraction at 2.95 Å resolution. Released 25 Jul 2012.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 12
Atoms: 22,870
Mol. weight: 494.69 kDa
Ligands: ADP
Released: 25 Jul 2012

Explore 3UK6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UK6 contains 228 α-helices and 208 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	1
α-helix	38	1
β-strand	39	1	1
α-helix	40	1
β-strand	42-43	2	2
β-strand	46-47	2	2
α-helix	50-64	15
β-strand	72-77	6	3
α-helix	83-94	12
β-strand	100-104	5	3
α-helix	105-108	4
α-helix	115-125	11
β-strand	127	1	4
β-strand	128-129	2	5
β-strand	242-243	2	5
α-helix	244-250	7
α-helix	270-286	17
β-strand	293	1	4
β-strand	295-299	5	3
α-helix	301-303	3
β-strand	305	1	6
α-helix	306-315	10
α-helix	321-322	2
β-strand	323-328	6	3
β-strand	332-334	3	7
α-helix	335	1
β-strand	336	1	6
β-strand	341-343	3	7
α-helix	348-351	4
β-strand	354-359	6	3
α-helix	360-362	3
α-helix	364-377	14
β-strand	382	1	8
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	8
α-helix	423-432	10
β-strand	434	1	9
α-helix	436-443	8

Chain B: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	10
α-helix	38	1
β-strand	39	1	10
α-helix	40	1
β-strand	42-43	2	11
β-strand	46-47	2	11
α-helix	50-64	15
β-strand	72-77	6	12
α-helix	83-94	12
β-strand	100-104	5	12
α-helix	105-108	4
α-helix	115-125	11
β-strand	127-130	4	13
β-strand	241-243	3	13
α-helix	244-250	7
α-helix	259-262	4
α-helix	267-269	3
α-helix	270-282	13
β-strand	292-293	2	13
β-strand	295-299	5	12
α-helix	301-303	3
β-strand	305	1	14
α-helix	306-315	10
α-helix	321-322	2
β-strand	323-328	6	12
β-strand	332-334	3	15
α-helix	335	1
β-strand	336	1	14
β-strand	341-343	3	15
α-helix	348-351	4
β-strand	354-359	6	12
α-helix	360-362	3
α-helix	364-377	14
β-strand	382	1	16
α-helix	384-396	13
α-helix	399-413	15
β-strand	421	1	16
α-helix	423-432	10
β-strand	434	1	3
α-helix	436-443	8

Chain C: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	17
α-helix	38	1
β-strand	39	1	17
α-helix	40	1
β-strand	42-43	2	18
β-strand	46-47	2	18
α-helix	50-64	15
β-strand	72-77	6	19
α-helix	83-94	12
β-strand	100-104	5	19
α-helix	105-108	4
α-helix	115-125	11
β-strand	127-130	4	20
β-strand	242-243	2	20
α-helix	244-250	7
α-helix	257-259	3
α-helix	270-286	17
β-strand	290-293	4	20
β-strand	295-299	5	19
α-helix	301-303	3
β-strand	305	1	21
α-helix	306-315	10
β-strand	323-328	6	19
β-strand	332-334	3	22
α-helix	335	1
β-strand	336	1	21
β-strand	341-343	3	22
α-helix	348-351	4
β-strand	354-359	6	19
α-helix	360-363	4
α-helix	364-377	14
β-strand	382	1	23
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	23
α-helix	423-432	10
β-strand	434	1	12
α-helix	436-443	8

Chain D: 19 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	38-40	3
β-strand	42-43	2	24
β-strand	46-47	2	24
α-helix	50-64	15
β-strand	72-77	6	25
α-helix	83-94	12
β-strand	100-104	5	25
α-helix	105-108	4
α-helix	115-125	11
β-strand	127-128	2	26
β-strand	243	1	26
α-helix	244-250	7
α-helix	267-269	3
α-helix	270-282	13
β-strand	292-293	2	26
β-strand	295-299	5	25
α-helix	301-303	3
β-strand	305	1	27
α-helix	306-315	10
α-helix	321-322	2
β-strand	323-328	6	25
β-strand	332-334	3	28
α-helix	335	1
β-strand	336	1	27
β-strand	341-343	3	28
α-helix	348-351	4
β-strand	354-359	6	25
α-helix	360-362	3
α-helix	364-377	14
β-strand	382	1	29
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	29
α-helix	423-432	10
β-strand	434	1	19
α-helix	436-442	7

Chain E: 19 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	30
α-helix	38	1
β-strand	39	1	30
α-helix	40	1
β-strand	42-43	2	31
β-strand	46-47	2	31
α-helix	50-64	15
β-strand	72-77	6	32
α-helix	83-94	12
β-strand	100-104	5	32
α-helix	105-108	4
α-helix	115-124	10
β-strand	127	1	33
α-helix	244-250	7
α-helix	272-284	13
β-strand	293	1	33
β-strand	295-299	5	32
α-helix	301-303	3
β-strand	305	1	34
α-helix	306-315	10
α-helix	321-322	2
β-strand	323-328	6	32
β-strand	332-334	3	35
α-helix	335	1
β-strand	336	1	34
β-strand	341-343	3	35
α-helix	348-351	4
β-strand	354-359	6	32
α-helix	360-363	4
α-helix	364-377	14
β-strand	382	1	36
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	36
α-helix	423-432	10
β-strand	434	1	37
α-helix	436-443	8

Chain F: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	38
α-helix	38	1
β-strand	39	1	38
α-helix	40	1
β-strand	42-43	2	39
β-strand	46-47	2	39
α-helix	50-64	15
β-strand	72-77	6	40
α-helix	83-94	12
β-strand	100-104	5	40
α-helix	105-108	4
α-helix	115-125	11
β-strand	127-130	4	41
β-strand	241-243	3	41
α-helix	244-250	7
α-helix	270-283	14
β-strand	292-293	2	41
β-strand	295-299	5	40
α-helix	301-303	3
β-strand	305	1	42
α-helix	306-315	10
α-helix	321-322	2
β-strand	323-328	6	40
β-strand	332-334	3	43
α-helix	335	1
β-strand	336	1	42
β-strand	341-343	3	43
α-helix	348-351	4
β-strand	354-359	6	40
α-helix	360-362	3
α-helix	364-377	14
β-strand	382	1	44
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	44
α-helix	423-432	10
β-strand	434	1	32
α-helix	436-443	8

Chain G: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	45
α-helix	38	1
β-strand	39	1	45
α-helix	40	1
β-strand	42-43	2	46
β-strand	46-47	2	46
α-helix	50-64	15
β-strand	72-77	6	47
α-helix	83-94	12
β-strand	100-104	5	47
α-helix	105-108	4
α-helix	115-125	11
β-strand	127-130	4	48
β-strand	242-243	2	48
α-helix	244-250	7
α-helix	256-259	4
α-helix	267-269	3
α-helix	270-286	17
β-strand	290-293	4	48
β-strand	295-299	5	47
α-helix	301-303	3
β-strand	305	1	49
α-helix	306-315	10
α-helix	321-322	2
β-strand	323-328	6	47
β-strand	332-334	3	50
α-helix	335	1
β-strand	336	1	49
β-strand	341-343	3	50
α-helix	348-351	4
β-strand	354-359	6	47
α-helix	360-362	3
α-helix	364-377	14
β-strand	382	1	51
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	51
α-helix	423-432	10
β-strand	434	1	40
α-helix	436-443	8

Chain H: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	52
β-strand	46-47	2	52
α-helix	50-62	13
β-strand	72-77	6	53
α-helix	83-94	12
β-strand	100-104	5	53
α-helix	105-108	4
α-helix	115-125	11
β-strand	127	1	54
β-strand	128	1	55
β-strand	243	1	55
α-helix	244-250	7
α-helix	270-282	13
β-strand	293	1	54
β-strand	295-299	5	53
α-helix	301-303	3
β-strand	305	1	56
α-helix	306-315	10
α-helix	321-322	2
β-strand	323-328	6	53
β-strand	332-334	3	57
α-helix	335	1
β-strand	336	1	56
β-strand	341-343	3	57
α-helix	348-351	4
β-strand	354-359	6	53
α-helix	360-363	4
α-helix	364-377	14
β-strand	382	1	58
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	58
α-helix	423-432	10
β-strand	434	1	47
α-helix	436-443	8

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RuvB-like 2	A, B, C, D, E, F, G, H, I, J, K, L	protein	368	Homo sapiens	Q9Y230 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>3UK6_1 RuvB-like 2 (chains A, B, C, D, E, F, G, H, I, J, K, L)
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKAGAVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEW
REEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSP
HGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAI
QLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
LEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	12

Primary citation

Large-Scale Conformational Flexibility Determines the Properties of AAA+ TIP49 ATPases. Petukhov, M., Dagkessamanskaja, A., Bommer, M. et al. Structure (2012) 20:1321-1331. DOI 10.1016/j.str.2012.05.012 · PubMed

Other PDB entries of the same protein (UniProt Q9Y230 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9EMA 2.4 Å, RUVBL1/2 in complex with ATP and CB-6644 inhibitor
6K0R 2.5 Å, Ruvbl1-Ruvbl2 with truncated domain II in complex with phosphorylated Cordycepin
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
6H7X 2.89 Å, First X-ray structure of full-length human RuvB-Like 2.
2XSZ 3.0 Å, The dodecameric human RuvBL1:RuvBL2 complex with truncated domains II
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
7ZI4 3.2 Å, Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex

Browse structure collections

About this viewer

MolViewer shows 3UK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.