3UQ3: TPR2AB-domain:pHSP90-complex of yeast Sti1

Name: PDB 3UQ3: TPR2AB-domain:pHSP90-complex of yeast Sti1
Published: 2012-01-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

TPR2AB-domain:pHSP90-complex of yeast Sti1. Determined by X-ray diffraction at 2.6 Å resolution. Released 18 Jan 2012.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Saccharomyces cerevisiae S288C, Saccharomyces cerevisiae
Chains: 3
Atoms: 2,184
Mol. weight: 30.59 kDa
Released: 18 Jan 2012

Explore 3UQ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UQ3 contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	259-274	16
α-helix	278-291	14
α-helix	296-307	12
α-helix	311-327	17
α-helix	332-348	17
α-helix	352-365	14
α-helix	369-390	22
α-helix	393-408	16
α-helix	412-425	14
α-helix	430-442	13
α-helix	446-459	14
α-helix	464-476	13
α-helix	480-498	19
α-helix	503-512	10

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	707-709	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein STI1	A	protein	258	Saccharomyces cerevisiae S288C	P15705 (AlphaFold model)
Heat shock protein	B, C	protein	5	Saccharomyces cerevisiae	P08238 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UQ3_1 Heat shock protein STI1 (chains A)
GGSMADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAIST
LNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRN
AEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRA
AALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEV
NNGSSAREIDQLYYKASQ

Sequence of entity 2 (B, C), FASTA

>3UQ3_2 Heat shock protein (chains B, C)
MEEVD

Primary citation

The architecture of functional modules in the Hsp90 co-chaperone Sti1/Hop. Schmid, A.B., Lagleder, S., Grawert, M.A. et al. EMBO J (2012) 31:1506-1517. DOI 10.1038/emboj.2011.472 · PubMed

Other PDB entries of the same protein (UniProt P15705 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UPV 1.6 Å, TPR2B-domain:pHsp70-complex of yeast Sti1
2LLV Solution structure of the yeast Sti1 DP1 domain
2LLW Solution structure of the yeast Sti1 DP2 domain

Browse structure collections

About this viewer

MolViewer shows 3UQ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.