3UUD: HERa-LBD

Crystal structure of hERa-LBD (Y537S) in complex with estradiol. Determined by X-ray diffraction at 1.6 Å resolution. Released 22 Aug 2012.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,459
Mol. weight: 61.38 kDa
Ligands: EST
Released: 22 Aug 2012

Explore 3UUD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UUD contains 31 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	307-309	3
α-helix	312-321	10
α-helix	323-325	3
α-helix	327-329	3
α-helix	339-361	23
α-helix	367-369	3
α-helix	372-395	24
β-strand	401-405	5	1
β-strand	408-411	4	1
α-helix	412-415	4
α-helix	422-438	17
α-helix	442-455	14
α-helix	467-469	3
α-helix	471-492	22
α-helix	497-530	34
α-helix	535-537	3
α-helix	538-545	8

Chain B: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	306-309	4
α-helix	312-322	11
α-helix	323-328	6
α-helix	339-361	23
α-helix	367-369	3
α-helix	372-395	24
β-strand	401-405	5	2
β-strand	408-411	4	2
α-helix	412-415	4
α-helix	422-437	16
α-helix	442-455	14
α-helix	458-460	3
α-helix	473-492	20
α-helix	497-531	35
α-helix	535-537	3
α-helix	538-545	8

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	689-695	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen receptor	A	protein	251	Homo sapiens	P03372 (AlphaFold model)
Estrogen receptor	B	protein	251	Homo sapiens	P03372 (AlphaFold model)
Nuclear receptor coactivator 1	C, D	protein	13	Homo sapiens	Q15788 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UUD_1 Estrogen receptor (chains A)
KKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWA
KRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGM
VEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDK
ITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLL
EMLDAHRLHAP

Sequence of entity 2 (B), FASTA

>3UUD_2 Estrogen receptor (chains B)
KKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWA
KRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGM
VEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDK
ITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLL
EMLDAHRLHAP

Sequence of entity 3 (C, D), FASTA

>3UUD_3 Nuclear receptor coactivator 1 (chains C, D)
RHKILHRLLQEGS

Ligands and cofactors

ID	Name	Formula	Copies
EST	Estradiol	C18 H24 O2	2

Water and common crystallization additives (EDO, GOL) are not listed.

Primary citation

Structural and mechanistic insights into bisphenols action provide guidelines for risk assessment and discovery of bisphenol A substitutes. Delfosse, V., Grimaldi, M., Pons, J.L. et al. Proc Natl Acad Sci U S A (2012) 109:14930-14935. DOI 10.1073/pnas.1203574109 · PubMed

Other PDB entries of the same protein (UniProt P03372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
8BZC 1.1 Å, co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244)
8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
7B9R 1.15 Å, Cys-45-tethered stabilizer 4 of 14-3-3(sigma)/ERa PPI
7B9T 1.15 Å, Cys-45-tethered stabilizer 5 of 14-3-3(sigma)/ERa PPI
7NFW 1.19 Å, Human 14-3-3 sigma in complex with human Estrogen Receptor alpha peptide
6HMU 1.2 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C45 mutant bound to…
7BA8 1.2 Å, Cys-42-tethered stabilizer 10 of 14-3-3(sigma)/ERa PPI
8APS 1.2 Å, Small molecular stabilizer for ERalpha and 14-3-3 (1083744)
8BX3 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074372)
8BXI 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074361)

Browse structure collections

About this viewer

MolViewer shows 3UUD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.