3UV4: PDB entry 3UV4

Name: PDB 3UV4: Crystal Structure of the second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1)
Published: 2012-03-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of the second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1). Determined by X-ray diffraction at 1.89 Å resolution. Released 14 Mar 2012.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,348
Mol. weight: 37.08 kDa
Ligands: PO4
Released: 14 Mar 2012

Explore 3UV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UV4 contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	1523-1535	13
α-helix	1536-1540	5
α-helix	1547-1549	3
α-helix	1561-1564	4
α-helix	1571-1579	9
α-helix	1586-1604	19
α-helix	1609-1627	19
α-helix	1629-1642	14

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	1523-1534	12
α-helix	1535-1539	5
α-helix	1540-1542	3
α-helix	1547-1549	3
α-helix	1561-1564	4
α-helix	1571-1579	9
α-helix	1586-1603	18
α-helix	1609-1627	19
α-helix	1629-1644	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1)	A, B	protein	158	Homo sapiens	P21675 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3UV4_1 second bromodomain of human Transcription initiation factor TFIID subunit 1 (TAF1) (chains A, B)
MHHHHHHSSGVDLGTENLYFQSMDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFV
PDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIV
NVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLD

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (GOL, EDO) are not listed.

Primary citation

Histone recognition and large-scale structural analysis of the human bromodomain family. Filippakopoulos, P., Picaud, S., Mangos, M. et al. Cell (2012) 149:214-231. DOI 10.1016/j.cell.2012.02.013 · PubMed

Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I29 1.21 Å, TAF1(2) bound to a pyrrolopyridone compound
7LB1 1.35 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-585
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
5I1Q 1.5 Å, Second bromodomain of TAF1 bound to a pyrrolopyridone compound
7K27 1.5 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ATR…
7JJG 1.6 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K03 1.6 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ATR…
7T36 1.65 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ZS1-322
7JSP 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K3O 1.7 Å, Crystal structure of the unliganded second bromodomain (BD2) of human TAF1
7K42 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to dioxane
7LB2 1.7 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-589

Browse structure collections

About this viewer

MolViewer shows 3UV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.